DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and cytb-5.1

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_510335.2 Gene:cytb-5.1 / 181510 WormBaseID:WBGene00007848 Length:134 Species:Caenorhabditis elegans


Alignment Length:128 Identity:61/128 - (47%)
Similarity:82/128 - (64%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDA 69
            :.|..|..|:|:|||||..||:|.|.::|||.||:|||||.|||:||||.|.||.|||||||.||
 Worm     3 DLKQITLKEIAEHNTNKSAWLVIGNKVFDVTKFLDEHPGGCEVLLEQAGSDGTEAFEDVGHSTDA 67

  Fly    70 RDMMKKYKIGELVESERTSVA-QKSEPTWSTEQQTEESSVKSW------LVPLVLCLVATLFY 125
            |.|..:|.|||:|.|||.:.: .|.:...:|||..::...:|.      ...|:..:||.::|
 Worm    68 RHMKDEYLIGEVVASERKTYSYDKKQWKSTTEQDNKQRGGESMQTDNIVYFALLAVIVALVYY 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 46/72 (64%)
cytb-5.1NP_510335.2 Cyt-b5 8..80 CDD:365921 47/71 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166696
Domainoid 1 1.000 103 1.000 Domainoid score I4286
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41475
Inparanoid 1 1.050 114 1.000 Inparanoid score I3404
Isobase 1 0.950 - 0 Normalized mean entropy S967
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - oto17942
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - LDO PTHR19359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 1 1.000 - - X609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.780

Return to query results.
Submit another query.