DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and D2023.1

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001256372.1 Gene:D2023.1 / 179615 WormBaseID:WBGene00014300 Length:337 Species:Caenorhabditis elegans


Alignment Length:101 Identity:19/101 - (18%)
Similarity:34/101 - (33%) Gaps:38/101 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TKTFTRAEVAKHNTN-KDTWLLIHNN-IYDV----------TAFLNEHPGGEEVLIEQAGKDATE 58
            |.||...:.:...|: ...|..|.|. :||:          |.||       :.||..       
 Worm   227 TSTFFLLKFSASLTDPSQKWTTIKNGFMYDILICIGTTCTTTVFL-------QFLIPD------- 277

  Fly    59 NFEDVGHSNDARDMMKKYKIGELVESERTSVAQKSE 94
                        |.:||:::...:..::.||..:.:
 Worm   278 ------------DTLKKWRLKFHLSCQQRSVTPEGK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 16/84 (19%)
D2023.1NP_001256372.1 Sre <96..>214 CDD:251743
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.