DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and fath-1

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_492678.1 Gene:fath-1 / 172882 WormBaseID:WBGene00007707 Length:316 Species:Caenorhabditis elegans


Alignment Length:131 Identity:29/131 - (22%)
Similarity:47/131 - (35%) Gaps:45/131 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YDVTAFLNEHPGGEEVLIEQAGKDATENFEDVG---------------HSNDARDMMKKYKIG-- 79
            ||:..|..:||||.:||...||       |::|               ||..|.:|:::|.:.  
 Worm    20 YDIADFAPKHPGGAKVLNRLAG-------EEIGEFIRGEKRIMGVRHEHSEAAYNMLERYNVNAI 77

  Fly    80 ----ELVESER---TSVAQKSEPTWSTEQQTEESSVKS--------------WLVPLVLCLVATL 123
                .|:||:.   ..|.......|....|..:.:::.              |:||.|...:...
 Worm    78 QKGDPLIESKSGMLFKVGSLGSEYWHWIHQPYDGTLRLFDSDVLESMTRTAWWVVPAVWMPIVIT 142

  Fly   124 F 124
            |
 Worm   143 F 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 18/69 (26%)
fath-1NP_492678.1 Cyt-b5 6..72 CDD:278597 17/58 (29%)
FA_hydroxylase 90..311 CDD:294712 8/54 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.