DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and cytb-5.2

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001379864.1 Gene:cytb-5.2 / 172393 WormBaseID:WBGene00020931 Length:141 Species:Caenorhabditis elegans


Alignment Length:149 Identity:57/149 - (38%)
Similarity:79/149 - (53%) Gaps:35/149 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETKTFTRAEVAKHN---TNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHS 66
            |.:..:..||:|||   .::..|::|...:||||.|||||||||||:.:.||||||..|.|||||
 Worm     3 ELRVISLDEVSKHNWEDADQSCWIVISGKVYDVTKFLNEHPGGEEVITQLAGKDATVGFLDVGHS 67

  Fly    67 NDARDMMKKYKIGELVESE----RTSVAQKSE-----------------PTWSTEQQTEESSVKS 110
            .||.:|..:|.||:|.||:    .|:.|:.|:                 |||:           :
 Worm    68 KDAIEMANEYLIGQLPESDVPKVETAAAKPSKNEKSSSLLNDFTEIMTSPTWT-----------N 121

  Fly   111 WLVPLVLCLVATLFYKFFF 129
            :|:|..:.||....||..|
 Worm   122 FLIPTTMGLVIYAVYKCMF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 40/75 (53%)
cytb-5.2NP_001379864.1 Cyt-b5 8..82 CDD:395121 40/73 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S967
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 1 1.000 - - X609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.700

Return to query results.
Submit another query.