DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and LOC1281027

DIOPT Version :10

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_001238402.2 Gene:LOC1281027 / 1281027 VectorBaseID:AGAMI1_003350 Length:124 Species:Anopheles gambiae


Alignment Length:86 Identity:48/86 - (55%)
Similarity:69/86 - (80%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSEETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGH 65
            |:..|.:.::.|:||:||...|.|::||:.:||||.||.|||||||||||.|||:||.:|:||||
Mosquito     1 MAPTELQQYSLAQVAEHNKPNDVWMVIHDKVYDVTKFLAEHPGGEEVLIEFAGKEATADFDDVGH 65

  Fly    66 SNDARDMMKKYKIGELVESER 86
            |.||::.||::.:||::|:||
Mosquito    66 STDAKEQMKQFLVGEIIEAER 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 10..82 CDD:459698 43/71 (61%)
LOC1281027XP_001238402.2 None

Return to query results.
Submit another query.