powered by:
Protein Alignment Cyt-b5 and CYB5D1
DIOPT Version :9
Sequence 1: | NP_610294.1 |
Gene: | Cyt-b5 / 35688 |
FlyBaseID: | FBgn0264294 |
Length: | 134 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_653208.2 |
Gene: | CYB5D1 / 124637 |
HGNCID: | 26516 |
Length: | 228 |
Species: | Homo sapiens |
Alignment Length: | 72 |
Identity: | 23/72 - (31%) |
Similarity: | 39/72 - (54%) |
Gaps: | 7/72 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 ETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGG--EEVLIEQAGKDATENFEDVGHSN 67
:.:.||.||||:||..:|.|:.....:||:|:...|:.|. .:.::|.||:|.:..|:.
Human 16 QRRYFTPAEVAQHNRPEDLWVSYLGRVYDLTSLAQEYKGNLLLKPIVEVAGQDISHWFDP----- 75
Fly 68 DARDMMK 74
..||:.|
Human 76 KTRDIRK 82
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5274 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.