DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-b5 and Cyb5a

DIOPT Version :9

Sequence 1:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_080073.1 Gene:Cyb5a / 109672 MGIID:1926952 Length:134 Species:Mus musculus


Alignment Length:127 Identity:60/127 - (47%)
Similarity:86/127 - (67%) Gaps:1/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSEETKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHS 66
            |.::.|.:|..|:.||..:|.||:::|:.:||:|.||.|||||||||.||||.||||||||||||
Mouse     5 SDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHS 69

  Fly    67 NDARDMMKKYKIGELVESERTSVAQKSEPTWSTEQQTEESSVKSWLVPLVLCLVATLFYKFF 128
            .|||::.|.|.||||...:|:.:|:.|: |..|..::..|...:|::|.:..|...|.|:.:
Mouse    70 TDARELSKTYIIGELHPDDRSKIAKPSD-TLITTVESNSSWWTNWVIPAISALAVALMYRLY 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 45/72 (63%)
Cyb5aNP_080073.1 Cyt-b5 13..85 CDD:306642 46/71 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41475
Inparanoid 1 1.050 130 1.000 Inparanoid score I4618
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm44110
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - LDO PTHR19359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 1 1.000 - - X609
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.