DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and CRYZL1

DIOPT Version :10

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_665857.2 Gene:CRYZL1 / 9946 HGNCID:2420 Length:349 Species:Homo sapiens


Alignment Length:49 Identity:14/49 - (28%)
Similarity:24/49 - (48%) Gaps:12/49 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NTFYSNKEIFLRELIS-------NSSDALDKIR----YESLTDPSKLES 62
            ||.|.|| :.|.::||       :..|.|..:.    ::::|..|:.||
Human   214 NTVYLNK-LGLYDVISTLRLPWTSRGDVLCCVENVALHQNITSISQAES 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 MDR 144..428 CDD:450120
CRYZL1NP_665857.2 enoyl_red 31..347 CDD:176179 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.