DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and TP53I3

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_004872.2 Gene:TP53I3 / 9540 HGNCID:19373 Length:332 Species:Homo sapiens


Alignment Length:304 Identity:61/304 - (20%)
Similarity:122/304 - (40%) Gaps:67/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 REGSFFP--------GFEVAGVIESLGSEITEANNRG-LRIGQRVI-VYPFDETPAGYAELLVVP 192
            |:|.:.|        |.|.:|.:..||     ...:| .:||...: :.|    ..|.|:.:.||
Human    47 RQGQYDPPPGASNILGLEASGHVAELG-----PGCQGHWKIGDTAMALLP----GGGQAQYVTVP 102

  Fly   193 DLKHVVPIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILI-VGTGGL 256
            : ..::|||:.|.:..||.:|.    ||...|:...:|..:         :....:|| .|..|:
Human   103 E-GLLMPIPEGLTLTQAAAIPE----AWLTAFQLLHLVGNV---------QAGDYVLIHAGLSGV 153

  Fly   257 ALWAVRIASYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLIERTKDVCGG 321
            ...|:::      |..|..:.:..|..:.: .::|.::...:...:.:..:....::.||   |.
Human   154 GTAAIQL------TRMAGAIPLVTAGSQKK-LQMAEKLGAAAGFNYKKEDFSEATLKFTK---GA 208

  Fly   322 AVDVVID-FGTTSRSLHRSMHCLS-KGGVVL--------ISDEVAEKLLPKFSRL--------SE 368
            .|::::| .|  .....::::||: .|..||        |:..:..|||.|...|        ..
Human   209 GVNLILDCIG--GSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDN 271

  Fly   369 QYQQEIIAISNGTAEQLAELVELVANKKIEPPPHSVFPCEQAAE 412
            :|:|.::   |...||:.........:::.|....::|..:..|
Human   272 KYKQMLV---NAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 59/300 (20%)
MDR 144..428 CDD:302572 59/298 (20%)
TP53I3NP_004872.2 p53_inducible_oxidoreductase 1..328 CDD:176180 61/304 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.