DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and AST2

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_011027.1 Gene:AST2 / 856838 SGDID:S000000903 Length:430 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:57/263 - (21%)
Similarity:100/263 - (38%) Gaps:57/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 SPAHQGIREGSFFP-------GFEVAGVIESLGSEITEANNRGLRIGQRVI-VYPFDETPAG--Y 185
            :|....||.|...|       |.|.:|||..:|..:|...|    :|..|. :|...:...|  .
Yeast    89 NPVDMKIRNGYTKPIYGEAGIGREYSGVITHVGDNLTNRWN----VGDDVYGIYYHPKLAIGALQ 149

  Fly   186 AELLVVPDLKHVVPIP-DSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQ-RAATEPKRKPKI 248
            :.||:.|.:..::..| ::|..|.||    |:|.......       .:|:| :...:...:..:
Yeast   150 SSLLIDPRVDPILMRPKNTLSPEKAA----GSLFCLGTAL-------NLLAQLKEKDQLNTESNV 203

  Fly   249 LI-VGTGGLALWAVR----------------------IASYHFATTGADNVDITVASLRDEGFR- 289
            || .||..:.::|::                      :.|.||.....:.:.|...|.|.:..: 
Yeast   204 LINGGTSSVGMFAIQLLKRYYKVSKKLVVVTSGNGAAVLSEHFPDLKDEIIFINYLSCRGKSSKP 268

  Fly   290 LATEIKNVSVVQWNECLYEPQLIERTKDVCGGAVDVVIDF-GTTSRSLHRSMHCLSKGG-VVLIS 352
            |...:....||.:::.    ..::.|:|...|..:||:|| |......|.|....:||. :..:.
Yeast   269 LRRMLDTGKVVDYDDF----NTLKETEDYTQGKFNVVLDFIGGYDILSHSSSLIHAKGAYITTVG 329

  Fly   353 DEV 355
            |.|
Yeast   330 DYV 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 53/252 (21%)
MDR 144..428 CDD:302572 53/250 (21%)
AST2NP_011027.1 AST1_like 50..427 CDD:176209 57/263 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343178
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.