DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and YIM1

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_013872.1 Gene:YIM1 / 855183 SGDID:S000004760 Length:365 Species:Saccharomyces cerevisiae


Alignment Length:385 Identity:72/385 - (18%)
Similarity:134/385 - (34%) Gaps:98/385 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NSITSMSSVSSEL-------------SDYCPSVNSMSSPAHQGIREGSF--FP---GFEVAGVIE 153
            |:.|.::..||||             ..:..::|.:....||......|  :|   ..:.:|||.
Yeast    15 NNTTPVTITSSELDLRSCYQDDEVVIEVHAAALNPIDFITHQLCNSYIFGKYPKTYSRDYSGVII 79

  Fly   154 SLGSEITEANNRGLRIGQRV-----IVYPFDETPAGYAELLVVPD--LKHVVPIP--DSLPME-- 207
            ..|.::   :|| .::|.:|     .:|....|...|..|....|  :.|:|.:|  ::.|.:  
Yeast    80 KAGKDV---DNR-WKVGDKVNGMYSHIYGERGTLTHYLILNPAKDVPITHMVEVPKDENDPYDDF 140

  Fly   208 -VAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILIVGTGGLALWA-VRIASYHFAT 270
             .||..|.....|::.::..:...|.            ..|:|::|......:| |.||..:|  
Yeast   141 VYAAAWPLTFGTAFSTLYDFKKDWTS------------DSKVLVIGASTSVSYAFVHIAKNYF-- 191

  Fly   271 TGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLIERTKDVCGGAV-----DVVID-- 328
                |:...|............::....:|.::    |..::|..|.:....:     |::.|  
Yeast   192 ----NIGTVVGICSKNSIERNKKLGYDYLVPYD----EGSIVENVKKLKQSVLENDKFDMIFDSV 248

  Fly   329 -----FGTTSRSL----HRSMHCLSKGG-------------VVLISDEVAEKLLPKFS-RLSEQY 370
                 |....:.|    ..|.:....|.             |.|.|...|.....|:: |....|
Yeast   249 GNHDFFPVIDQFLKPKAKNSFYVTIAGNNKADYKNISWRDFVSLSSILKAINPFKKYNWRFGHPY 313

  Fly   371 -QQEIIAISNGTAEQLAELVELVANKKIEPPPHSVFPCEQAAEVIAKLCNSEIPGRAILR 429
             ....|.:.|          |::.....:||..||:..:|..|.|.:|.::...|:.:::
Yeast   314 PPNNFIEVGN----------EMIKKGTYKPPIDSVYEFDQYKEAIDRLMSNRAKGKVVVK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 63/337 (19%)
MDR 144..428 CDD:302572 62/330 (19%)
YIM1NP_013872.1 AST1_like 8..364 CDD:176209 72/385 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.