DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and ZTA1

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_009602.1 Gene:ZTA1 / 852335 SGDID:S000000250 Length:334 Species:Saccharomyces cerevisiae


Alignment Length:333 Identity:74/333 - (22%)
Similarity:125/333 - (37%) Gaps:52/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SVSSE---LSDYCPSVNSMSSPAHQGIR--EGSFFPGFEVAGVIESLGSEITEANNRGLRIGQRV 173
            |:|.|   :.:....||.:.|...:||.  |..:..|.|.:|.:.:.|..:|     ...:|.:|
Yeast    32 SISEEELLIKNKYTGVNYIESYFRKGIYPCEKPYVLGREASGTVVAKGKGVT-----NFEVGDQV 91

  Fly   174 IVYPFDETPAGYAELLVVPDLKHVVPIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRA 238
             .|..:.|.|.|::   :.....|:.:|.....|...:...|.|          .|:|.:.....
Yeast    92 -AYISNSTFAQYSK---ISSQGPVMKLPKGTSDEELKLYAAGLL----------QVLTALSFTNE 142

  Fly   239 ATEPKRKPKILI-VGTGGLALWAVRIASYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQW 302
            |...|:...:|: ...||:.|...::.....|.|      |.||| .||..::|.|.....::..
Yeast   143 AYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHT------IAVAS-TDEKLKIAKEYGAEYLINA 200

  Fly   303 NECLYEPQLIERTKDVCGGAVDVVIDFGTTSRSLHRSMHCLSKGGVVLISDEVAEKLLPKFS--R 365
            ::   |..|.:..|...|..||...| .....:...|:..|.:.| |.:|...|..|:|.||  |
Yeast   201 SK---EDILRQVLKFTNGKGVDASFD-SVGKDTFEISLAALKRKG-VFVSFGNASGLIPPFSITR 260

  Fly   366 LSEQYQQEIIAISNGTAEQLA----------ELVELVANKKIEPPPHSVFPCEQAAEVIAKLCNS 420
            ||   .:.|..:.......:|          |...||.:||:....:..:|........|.:.:.
Yeast   261 LS---PKNITLVRPQLYGYIADPEEWKYYSDEFFGLVNSKKLNIKIYKTYPLRDYRTAAADIESR 322

  Fly   421 EIPGRAIL 428
            :..|:.:|
Yeast   323 KTVGKLVL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 65/300 (22%)
MDR 144..428 CDD:302572 64/296 (22%)
ZTA1NP_009602.1 QOR2 10..332 CDD:176189 74/333 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.