DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and ETR1

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_009582.1 Gene:ETR1 / 852314 SGDID:S000000230 Length:380 Species:Saccharomyces cerevisiae


Alignment Length:324 Identity:67/324 - (20%)
Similarity:111/324 - (34%) Gaps:95/324 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 DYCPSVNSMSSPAHQGIREGSFFPGFEVAGVIESLGSEITEANNRG-LRIGQRVIVYPFDETPAG 184
            ||     |...||.....||.    |||.        .:...:::| |::|.|||  |.......
Yeast    82 DY-----STDEPAAIAGNEGV----FEVV--------SLPSGSSKGDLKLGDRVI--PLQANQGT 127

  Fly   185 YAELLVVPDLKHVVPIPDSLPMEVAAMLP----TGALLA-----WNAVFKAQAVVTQILSQRAAT 240
            ::...|......::.:.| |.:..||.:.    ||..|.     ||      :...:.:.|.|.|
Yeast   128 WSNYRVFSSSSDLIKVND-LDLFSAATVSVNGCTGFQLVSDYIDWN------SNGNEWIIQNAGT 185

  Fly   241 EPKRKPKILIVGTGGLALWAVRIASYHFATTGADNVDITVASLRDE-GFRLATEIKNVSVVQWNE 304
            ....|....:....|:...:|        ....||.|.....|.|: |   ||::  :|..|.|:
Yeast   186 SSVSKIVTQVAKAKGIKTLSV--------IRDRDNFDEVAKVLEDKYG---ATKV--ISESQNND 237

  Fly   305 CLYEPQLIER----------TKDVCGGAVD-----------VVIDFGTTSR-------SLHRSMH 341
            ..:..:::.:          ..:..||...           :::.:|..|:       |||....
Yeast   238 KTFAKEVLSKILGENARVRLALNSVGGKSSASIARKLENNALMLTYGGMSKQPVTLPTSLHIFKG 302

  Fly   342 CLSKG-------------GVVLISDEVAEKLLPKFSRLSEQYQQEIIAISNGTA--EQLAELVE 390
            ..|||             .:..|||.:  |:......:|.:.:.|.:..:..|.  |||.|||:
Yeast   303 LTSKGYWVTEKNKKNPQSKIDTISDFI--KMYNYGHIISPRDEIETLTWNTNTTTDEQLLELVK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 60/303 (20%)
MDR 144..428 CDD:302572 60/301 (20%)
ETR1NP_009582.1 ETR 21..345 CDD:176250 59/303 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.