DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and BDH2

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_009340.1 Gene:BDH2 / 851238 SGDID:S000000057 Length:417 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:51/277 - (18%)
Similarity:96/277 - (34%) Gaps:107/277 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 FFP-----------------GFEVAGVIESLGSEITEANNRGLRIGQRVIV---------YPFDE 180
            |||                 |.|:||.:..:|..:     :.|::|.:|:|         |.:..
Yeast    52 FFPEDGHTHEISHNPLPQAMGHEMAGTVLEVGPGV-----KNLKVGDKVVVEPTGTCRDRYRWPL 111

  Fly   181 TP------------------------------AGYAELLVVPDLKHVVPIPDSLPMEVAAMLPTG 215
            :|                              .|:||.:|:.: .|...:||.:|::|||::...
Yeast   112 SPNVDKEWCAACKKGYYNICSYLGLCGAGVQSGGFAERVVMNE-SHCYKVPDFVPLDVAALIQPL 175

  Fly   216 ALLAWNAV----FKAQAVVTQILSQRAATEPKRKPKILIVGTGGLALWAVRIASYHFATTGADNV 276
            | :.|:|:    |||.:..                  ||:|.|.:.|..:      .|...|...
Yeast   176 A-VCWHAIRVCEFKAGSTA------------------LIIGAGPIGLGTI------LALNAAGCK 215

  Fly   277 DITVASLRDEGFRLATEIKNVSVVQWNECLYEP------QLIERTKDVC--GGAVDVVIDFGTTS 333
            ||.|:.        ..:::.....:....:|:|      :.|:..:.:.  |...|...|.....
Yeast   216 DIVVSE--------PAKVRRELAEKMGARVYDPTAHAAKESIDYLRSIADGGDGFDYTFDCSGLE 272

  Fly   334 RSLHRSMHCLSKGGVVL 350
            .:|:.::.||:..|..:
Yeast   273 VTLNAAIQCLTFRGTAV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 51/277 (18%)
MDR 144..428 CDD:302572 49/275 (18%)
BDH2NP_009340.1 butanediol_DH_like 1..375 CDD:176195 51/277 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.