DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and RTN4IP1

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_116119.2 Gene:RTN4IP1 / 84816 HGNCID:18647 Length:396 Species:Homo sapiens


Alignment Length:326 Identity:78/326 - (23%)
Similarity:127/326 - (38%) Gaps:52/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SVNSMSSPAHQGIREGSFFP---GFEVAGVIESLGSEITEANNRGLRIGQRV--IVYPFDETPAG 184
            ::|....|.|..|: |..||   |.:|:||:...|.::     :..:.|..|  .|.|:.:   |
Human    98 ALNMKRDPLHVKIK-GEEFPLTLGRDVSGVVMECGLDV-----KYFKPGDEVWAAVPPWKQ---G 153

  Fly   185 YAELLVVPDLKHVVPIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKIL 249
            .....||.....|...|.||....||.||..||.||:|:.|...     |:.:..|    ..::|
Human   154 TLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGG-----LNDKNCT----GKRVL 209

  Fly   250 IVG-TGGLALWAVRIASYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQL-- 311
            |:| :||:..:|:::..       |.:..:|....:|.. .|..::....|:.:.....|.||  
Human   210 ILGASGGVGTFAIQVMK-------AWDAHVTAVCSQDAS-ELVRKLGADDVIDYKSGSVEEQLKS 266

  Fly   312 ---IERTKDVCGGAVDV-VIDF-----GTTSRSLHR----SMHCLS-KGGVVLISDEVAEKLLPK 362
               .:...|..||:.:. ..||     |.|..:|..    :|..|. ..|::.....|..|.|..
Human   267 LKPFDFILDNVGGSTETWAPDFLKKWSGATYVTLVTPFLLNMDRLGIADGMLQTGVTVGSKALKH 331

  Fly   363 FSRLSEQYQQEIIAISNGTAEQLAELVELVANKKIEPPPHSVFPCEQAAEVIAKLCNSEIPGRAI 427
            |.: ...|:......|....:.:||||:.   .||.|.....||..:..|...|:......|:.:
Human   332 FWK-GVHYRWAFFMASGPCLDDIAELVDA---GKIRPVIEQTFPFSKVPEAFLKVERGHARGKTV 392

  Fly   428 L 428
            :
Human   393 I 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 73/309 (24%)
MDR 144..428 CDD:302572 72/305 (24%)
RTN4IP1NP_116119.2 RTN4I1 43..394 CDD:176210 78/326 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.