DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and AT5G42250

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_199040.1 Gene:AT5G42250 / 834230 AraportID:AT5G42250 Length:390 Species:Arabidopsis thaliana


Alignment Length:308 Identity:56/308 - (18%)
Similarity:100/308 - (32%) Gaps:106/308 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RIRIVCAGACYRRRDRANSITSMSSVSSELSDYCPSVNSMSSPAHQGIREGSFFP---GFEVAGV 151
            ||||:|...|:         :.::....::...|                   ||   |.|..||
plant    47 RIRIICTALCH---------SDVTFWKLQVPPAC-------------------FPRILGHEAIGV 83

  Fly   152 IESLGSEITEANNRGLRIGQRVI----------------------VYPFDETP------------ 182
            :||:|..:.|...     |..|:                      .:||..:|            
plant    84 VESVGENVKEVVE-----GDTVLPTFMPDCGDCVDCKSHKSNLCSKFPFKVSPWMPRYDNSSRFT 143

  Fly   183 -------------AGYAELLVVPDLKHVVPIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQIL 234
                         :.::|..|: |:.:||.|..|:|...|.:|..|......|.::...|     
plant   144 DLNGETLFHFLNVSSFSEYTVL-DVANVVKIDSSIPPSRACLLSCGVSTGVGAAWETAKV----- 202

  Fly   235 SQRAATEPKRKPKILIVGTGGLALWAVRIASYHFATTGADNVDITVASLR-DEGFRLATEIKNVS 298
             ::.:|       ::|.|.|.:.| ||...:.....:....|||.....: .:.|.: ||..|..
plant   203 -EKGST-------VVIFGLGSIGL-AVAEGARLCGASRIIGVDINPTKFQVGQKFGV-TEFVNSM 257

  Fly   299 VVQWNECLYEPQLIERTKDVCGGAVDVVIDFGTTSRSLHRSMHCLSKG 346
            ..:.|      ::.|...::..|..|...:...:|..:..:..|..:|
plant   258 TCEKN------RVSEVINEMTDGGADYCFECVGSSSLVQEAYACCRQG 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 49/256 (19%)
MDR 144..428 CDD:302572 48/254 (19%)
AT5G42250NP_199040.1 alcohol_DH_plants 17..388 CDD:176261 56/308 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D771875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.