DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and tp53i3

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_021323212.1 Gene:tp53i3 / 796473 ZFINID:ZDB-GENE-120220-1 Length:362 Species:Danio rerio


Alignment Length:361 Identity:82/361 - (22%)
Similarity:127/361 - (35%) Gaps:120/361 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PAHQGIREGSFFPGFEVAGVIESLGSEITEANNRGLRIGQRVIVYPFDETPAGYAELLVVPDLKH 196
            ||..|..|   ..|.|.:|||..:|..:    .....:|.:|:..   ....||||.:.||: :.
Zfish    55 PAPPGESE---ILGLEASGVISGVGPGV----KGNWTLGSKVMAL---LGGGGYAEYVAVPE-EL 108

  Fly   197 VVPIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILI-VGTGGLALWA 260
            |:.:|..|.:..||.||...|.|           .|:|...|...|..  .:|| .|..|:...|
Zfish   109 VMEVPSHLSLYEAAALPETWLTA-----------HQLLHFIAKVRPNE--TVLIHAGASGVGTAA 160

  Fly   261 VRIASYHFA----TTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLIERTKDVCGG 321
            |::.....|    |||:           .|..|.|.:|.....:.:.|.....::::.||   |.
Zfish   161 VQLVRLSHAIPVVTTGS-----------PEKIRFAEQIGAALGINYKEEDISEKVLQFTK---GK 211

  Fly   322 AVDVVID----------------------FGTTSRSLHRSMHCLSKGGVVLISD-EVAEKLLPKF 363
            ..||::|                      :||             .||..  || ::..|||.|.
Zfish   212 GADVILDCIGGNYWEKNISSLAVDGRWVLYGT-------------MGGKT--SDGDLLGKLLRKR 261

  Fly   364 SRL--------SEQYQQEIIA--------------ISNGTAEQLAELVELVANKKIEPPPH---- 402
            ..|        |.||:.|::.              :|| .:...||||:....:.:   ||    
Zfish   262 GHLLCSLLRSRSLQYKAELVQSFTQQVLPHFKSTDLSN-QSRYKAELVQSFTQQVL---PHFKST 322

  Fly   403 ---------SVFPCEQAAEVIAKLCNSEIPGRAILR 429
                     |:|..|.|.|....:..::..|:.|::
Zfish   323 DSPLRPVIDSMFSMEDAEEAHQHMEANKNIGKIIIK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 78/351 (22%)
MDR 144..428 CDD:302572 77/346 (22%)
tp53i3XP_021323212.1 p53_inducible_oxidoreductase 8..351 CDD:176180 80/352 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.