DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and tp53i3

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_031757634.1 Gene:tp53i3 / 779670 XenbaseID:XB-GENE-953475 Length:361 Species:Xenopus tropicalis


Alignment Length:323 Identity:78/323 - (24%)
Similarity:137/323 - (42%) Gaps:71/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 REGSFFP--------GFEVAGVIESLGSEITEANNRGLRIGQRVIVYPFDETPAGYAELLVVPDL 194
            |.|.:.|        |.|.||.:..||   ..|:.| .::|.:|:..   .:..|.||...|| .
 Frog    76 RRGKYAPPPGASDILGLEAAGTVVELG---LGADGR-WKVGDKVMAL---LSGGGNAEYATVP-A 132

  Fly   195 KHVVPIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILI-VGTGGLAL 258
            .|::|:|..:....||.:|.    ||...|:....|.::  |:..|       :|| .|..|:..
 Frog   133 GHLMPVPPGMSATDAAAIPE----AWLTAFQLLHFVGKV--QKGET-------VLIHAGASGVGT 184

  Fly   259 WAVRIASYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWN--ECLYEPQLIERTKDVCGG 321
            .|:::...      |..|.|..|...:   :|.|.||..:...:|  |..:..:.::.|.::  |
 Frog   185 AAIQLCRL------AGAVPIVTAGSHE---KLQTAIKLGAATGFNYKEENFGEKCLKFTNNI--G 238

  Fly   322 AVDVVIDFGTTSRSLHRSMHCLSKGGVVLI-----SDEVAEKLLPKF-------------SRLSE 368
            | ||::|....|. ..:::.||:..|..::     |.|:...||.|.             || |:
 Frog   239 A-DVILDCVGASH-WEKNLQCLNTDGRWVLYGLMGSGEIHGDLLAKLLWKRGSLLGSLLRSR-SK 300

  Fly   369 QYQQEIIAISNGTAEQLAELVELVANKKIE--PPPHSVFPCEQAAEVIAKLCNSEIPGRAILR 429
            :|::|::   ....||  .|...:|...|:  |...||||..|.::...::.:::..|:.:|:
 Frog   301 KYKEELV---KAFTEQ--ALPHFIAGGPIQLLPIVDSVFPLHQISDAHQRMEDNKNTGKIVLQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 76/319 (24%)
MDR 144..428 CDD:302572 75/314 (24%)
tp53i3XP_031757634.1 p53_inducible_oxidoreductase 30..357 CDD:176180 77/320 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.