DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and MECR

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_011539841.1 Gene:MECR / 51102 HGNCID:19691 Length:459 Species:Homo sapiens


Alignment Length:344 Identity:71/344 - (20%)
Similarity:125/344 - (36%) Gaps:118/344 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ITSMSSVSSEL-------SDYCPSVNSMSSPAH-------QGIREGSFFP------GFEVAGVIE 153
            |:|.|:|...|       ||.  .|..:::|.:       ||  ...|.|      |.|....:.
Human    81 ISSASTVLKNLELAAVRGSDV--RVKMLAAPINPSDINMIQG--NYGFLPELPAVGGNEGVAQVV 141

  Fly   154 SLGSEITEANNRGLRIGQRVIVYPFD------ETPAGYAELLVVPDLKHVVPIPDSLPMEVAAML 212
            ::||.:|     ||:.|..||  |.:      .|.|.::|       :.::.:|..:|::.||.|
Human   142 AVGSNVT-----GLKPGDWVI--PANAGLGTWRTEAVFSE-------EALIQVPSDIPLQSAATL 192

  Fly   213 PTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILIV---GTGGLALWAVRIASYHFATTGAD 274
            ......|:..:...:.:               :|...::   ...|:....::||    |..|..
Human   193 GVNPCTAYRMLMDFEQL---------------QPGDSVIQNASNSGVGQAVIQIA----AALGLR 238

  Fly   275 NVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLIERTKDVCGGAVDVVIDFGTTSRSLHR- 338
            .:::    :||.     .:|:.:|              :|.|.:  ||..|:     |...|.| 
Human   239 TINV----VRDR-----PDIQKLS--------------DRLKSL--GAEHVI-----TEEELRRP 273

  Fly   339 SMHCLSKGGVVLISDEVAEKLLPKFSRLSEQYQQEIIAISNGTAEQLAELVELVANKK----IEP 399
            .|....|         :.:..|.|...|::.:     .:..|:.|  :||..:..|.|    .||
Human   274 EMKNFFK---------IRKLRLRKEEMLNQNH-----IVYKGSRE--SELASVSPNSKPLNLPEP 322

  Fly   400 PPHSVFPCEQAAEVIAKLC 418
            |||:: |....|...::||
Human   323 PPHNM-PRHAPATACSQLC 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 60/297 (20%)
MDR 144..428 CDD:302572 59/295 (20%)
MECRXP_011539841.1 ETR 44..459 CDD:176250 71/344 (21%)
Qor 100..>269 CDD:223677 43/235 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.