DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and Stpg2

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_008759742.2 Gene:Stpg2 / 499719 RGDID:1591946 Length:574 Species:Rattus norvegicus


Alignment Length:125 Identity:30/125 - (24%)
Similarity:44/125 - (35%) Gaps:40/125 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LSLNSLSLTSVLPPTDPDHHNPHSTH--------------STHNMNKLCRQVSIESPGPGAKNCV 74
            |||:|.....|: .:||....|...|              :..|..|..:::..:.|||.:.:| 
  Rat    43 LSLSSKKDAYVV-SSDPGKAVPGPAHYNVSQAQYKIKGGRTLQNREKRFKKLISDGPGPASYDC- 105

  Fly    75 FNFFVPIEDTPALGARIRIVCAGACYRRRDRANSITSMSSVSSELSDYCPSVNSMSSPAH 134
                      |.||.        .|.|.|.:   |....:||..|.  .||:.| |..:|
  Rat   106 ----------PYLGT--------LCIRIRQK---ICRKPAVSRSLD--IPSIPS-SGKSH 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677
MDR 144..428 CDD:302572
Stpg2XP_008759742.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.