DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and cryzl1

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_005171038.1 Gene:cryzl1 / 436906 ZFINID:ZDB-GENE-040718-378 Length:352 Species:Danio rerio


Alignment Length:330 Identity:64/330 - (19%)
Similarity:130/330 - (39%) Gaps:85/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 GFEVAGVIESLGSEITEANNRGLRIGQRVI----------VYPFDETPAGYAELLVVPDLKHVVP 199
            |.|:|||:              |::|.:|:          :.|.|...:|...::::.:. ::||
Zfish    62 GREIAGVV--------------LQVGPKVMFFQPDDEVVGILPLDAEQSGLCSVVLIDEF-NLVP 111

  Fly   200 IPDSLP-MEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILIV-GTGGLALWAVR 262
            .|:.:. .|.||::..| |.|:.|:        ..|::.||.:     .:|:: |.....:.|::
Zfish   112 KPEKVSWFEAAAVIKDG-LRAYTAL--------HTLARMAAGQ-----TVLVLDGASPFGVLAIQ 162

  Fly   263 IASYHFATTGADNVDITVASLRDEGFRLATEIK-NVSVVQ---------WNECLYEPQLIERTKD 317
            :|.||       .|.:...:|..|..:...|:: ||.|.:         |:.   :..|::...:
Zfish   163 LAHYH-------GVKVLATALSPEDQKFLQELRPNVGVQESLLARVIRLWDA---KEDLVDSCLE 217

  Fly   318 VCGG-AVDVVIDFG-----------TTSRSLHRSMHCLSKGGVVLISDEVAEK-------LLPKF 363
            ..|| .||:::|.|           |.....|..:..||.||..:.:::..:.       |..|.
Zfish   218 ETGGLGVDIIVDSGVRLYDEEPEAQTKQPHKHDLLTLLSVGGHWVTTEQHLQLDPPDSHILFLKA 282

  Fly   364 SRLSEQYQQEIIAISNGTAEQLAELVELVANK----KIEPPPHSVFPCEQAAEVIAKLCNSEIPG 424
            :.|| ....|:..:|.....:...:::.|.||    ...|......|..:|...:..:...::..
Zfish   283 ASLS-FLNDEVWTVSRAKQGRYLHILKDVMNKLCMGTFRPQMEHPVPLYEATVSMEMVQRKQVRK 346

  Fly   425 RAILR 429
            |.:::
Zfish   347 RIVVK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 64/330 (19%)
MDR 144..428 CDD:302572 64/327 (20%)
cryzl1XP_005171038.1 Qor 1..351 CDD:223677 64/328 (20%)
enoyl_red 30..350 CDD:176179 64/327 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.