Sequence 1: | NP_610293.3 | Gene: | Drat / 35687 | FlyBaseID: | FBgn0033188 | Length: | 434 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524310.1 | Gene: | Fdh / 41311 | FlyBaseID: | FBgn0011768 | Length: | 379 | Species: | Drosophila melanogaster |
Alignment Length: | 199 | Identity: | 39/199 - (19%) |
---|---|---|---|
Similarity: | 59/199 - (29%) | Gaps: | 84/199 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 IEDTP--ALGARIRIVCAGACYRRRDRANSITSMSSVSSELSDYCPSVNSMSSPAHQGIREGSFF 143
Fly 144 P---GFEVAGVIESLGSEITEANNRGLRIGQRVIVYPFDE------------------------- 180
Fly 181 -TPAG-------------------YAELLVVPDLKHVVPIPDSLPMEVAAMLPTGALLAWNAVFK 225
Fly 226 AQAV 229 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Drat | NP_610293.3 | Qor | 142..430 | CDD:223677 | 27/136 (20%) |
MDR | 144..428 | CDD:302572 | 26/134 (19%) | ||
Fdh | NP_524310.1 | FrmA | 9..379 | CDD:223990 | 39/199 (20%) |
alcohol_DH_class_III | 9..378 | CDD:176260 | 39/199 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45445852 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |