DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and Sodh-1

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001287203.1 Gene:Sodh-1 / 40836 FlyBaseID:FBgn0024289 Length:360 Species:Drosophila melanogaster


Alignment Length:286 Identity:68/286 - (23%)
Similarity:104/286 - (36%) Gaps:70/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 GFEVAGVIESLGSEITEANNRGLRIGQRVIVYP----------------------FDETPAGYAE 187
            |.|.|||:..||.::|.     |::|.||.:.|                      |..||.....
  Fly    65 GHESAGVVAKLGKKVTT-----LKVGDRVAIEPGVPCRKCDHCKQGKYNLCPGMVFCATPPYDGN 124

  Fly   188 LLVVPDLKHVV----PIPDSLPMEVAAML-PTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPK 247
            |  ....||..    .:||.:.||..|:| |..  :..:|..:|:..:..              |
  Fly   125 L--TRYYKHAADFCFKLPDHVTMEEGALLEPLS--VGVHACKRAEVTLGS--------------K 171

  Fly   248 ILIVGTGGLALWAVRIASYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLI 312
            :||:|.|.:.|..:..|.    ..||.  :|.:..|..:...:|.|:.....:    .|...|..
  Fly   172 VLILGAGPIGLVTLMAAQ----AMGAS--EILITDLVQQRLDVAKELGATHTL----LLKRDQTA 226

  Fly   313 ERT----KDVCGGAVDVVIDFGTTSRSLHRSMHCLSKGG-VVLISDEVAEKLLPKFSRLSEQYQ- 371
            |.|    :...||..|..||......|...::.....|| ||::....||..||..:.|:.:.. 
  Fly   227 EETAVLVQKTMGGQPDKSIDCCGAESSARLAIFATRSGGIVVVVGMGAAEIKLPLINALAREVDI 291

  Fly   372 QEIIAISNGTAEQLAELVELVANKKI 397
            :.:....|..|..||    |||:.|:
  Fly   292 RGVFRYCNDYAAALA----LVASGKV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 68/286 (24%)
MDR 144..428 CDD:302572 68/286 (24%)
Sodh-1NP_001287203.1 PLN02702 4..346 CDD:215378 68/286 (24%)
sorbitol_DH 8..349 CDD:176188 68/286 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.