DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and rtn4ip1

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_956646.1 Gene:rtn4ip1 / 393323 ZFINID:ZDB-GENE-040426-1314 Length:359 Species:Danio rerio


Alignment Length:327 Identity:72/327 - (22%)
Similarity:126/327 - (38%) Gaps:79/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 REGSFFP---GFEVAGVIESLGSEITEANNRGLRIGQRV--IVYPFDETPAGYAELLVVP--DLK 195
            :.|..||   |.:|:|.|...|.::     :..:.|.:|  .:.|:.:  ...||.:||.  ::.
Zfish    68 QSGGEFPLILGRDVSGEIMECGLDV-----KYFKPGDQVWAAIPPWKQ--GSLAEFVVVSGNEVS 125

  Fly   196 HVVPIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILIV-GTGGLALW 259
            |.   |.||..:.||.:|..|..||:|:     |.|..|::    :...|.::||: |:||:..:
Zfish   126 HK---PKSLRHDEAASIPYVAATAWSAI-----VNTGGLNK----DNSAKKRVLILGGSGGVGTF 178

  Fly   260 AVRIA---SYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLIERTK----- 316
            |:::.   ..|...|.:.|.:           ||..::....||.:.....|.||....|     
Zfish   179 AIQMVKAWGAHVTVTCSQNAE-----------RLVRDLGADDVVDYTAGPVEKQLKNLEKFDLIL 232

  Fly   317 DVCGGA-----------------VDVVIDFGTTSRSLHRSMHCLSKG---GVVLISDEVAEKLLP 361
            |..||.                 |.::..|...:..|.     |:.|   ..|.:..:|.:.|  
Zfish   233 DSIGGETEKWALDLLKPWSGAKFVTLITPFLQNTDRLG-----LADGMMQSAVTVGCKVVKNL-- 290

  Fly   362 KFSRLSEQYQQEIIAISNGTAEQLAELVELVANKKIEPPPHSVFPCEQAAEVIAKLCNSEIPGRA 426
               |....|:....|.|....::::|:|:.   .|:.|....||...|..|...|:......|:.
Zfish   291 ---RKGVHYRWGFFAPSGSALDEVSEMVDA---GKVRPVVEEVFSFAQVPEAFQKVEQGHARGKT 349

  Fly   427 IL 428
            ::
Zfish   350 VV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 71/323 (22%)
MDR 144..428 CDD:302572 70/319 (22%)
rtn4ip1NP_956646.1 Qor 1..353 CDD:223677 72/327 (22%)
RTN4I1 1..352 CDD:176210 72/327 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.