DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and Stpg2

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_036019039.1 Gene:Stpg2 / 381476 MGIID:2685863 Length:562 Species:Mus musculus


Alignment Length:149 Identity:34/149 - (22%)
Similarity:51/149 - (34%) Gaps:20/149 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CSQPHNLLSSMSGTTDTSLSLNSLSLTSVLPPTDPDHHNPHST-------HSTHNMNKLCRQVSI 63
            |..|...|||     .||..:.|......:|  .|.|:|....       .|..|..|..:::..
Mouse    38 CYAPFLSLSS-----KTSACVVSSDAGQAVP--GPAHYNVSQAQYNIRGGRSLQNREKRFKKLIS 95

  Fly    64 ESPGPGAKNCVFNFFVPIEDTPALGARIRIVCAGACYRRRDRANSITSMSSVSSELSDYCPSVNS 128
            :.||||:.|.      |...|..:..|.:.....|..|..|..:..:|..|....|:|....:..
Mouse    96 DGPGPGSYNW------PYLGTLCITTRQKTPRTPAVSRNIDIPSIPSSGKSHGYHLNDDDTIMRR 154

  Fly   129 MSSPAHQGIREGSFFPGFE 147
            ...|:...|....:.|.|:
Mouse   155 TPPPSDNTIGPAYYNPQFD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 2/6 (33%)
MDR 144..428 CDD:302572 2/4 (50%)
Stpg2XP_036019039.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.