DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and Cryz

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001012183.1 Gene:Cryz / 362061 RGDID:1311639 Length:329 Species:Rattus norvegicus


Alignment Length:320 Identity:78/320 - (24%)
Similarity:129/320 - (40%) Gaps:79/320 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 SPAHQGIREGS--------FFPGFEVAGVIESLGSEITEANNRGLRIGQRVIVYPFDETPAGYAE 187
            :|....||.|:        :.||.:|||:|||:|..::     ..:.|.|  |:.|.....||||
  Rat    48 NPVETYIRSGTYSRKPALPYTPGSDVAGIIESVGDGVS-----AFKKGDR--VFCFSTVSGGYAE 105

  Fly   188 LLVVPDLKHVVPIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILIVG 252
            ..:..| ....|:|::|.....|.|......|..|:|.         |.||    :....:|:.|
  Rat   106 FALSAD-NTTYPLPETLDFRQGAALGIPYFTACRALFH---------SARA----RAGESVLVHG 156

  Fly   253 -TGGLALWAVRIASYH----FATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLI 312
             :||:.|...:||..|    ..|.|:           :||.:|..:.....|....|..|    |
  Rat   157 ASGGVGLATCQIARAHGLKVLGTAGS-----------EEGKKLVLQNGAHEVFNHKEANY----I 206

  Fly   313 ERTKDVCGG-AVDVVIDFGTTSRSLHRSMHCLSKGGVVLI-----------SDEVAEKL----LP 361
            ::.|...|. .|||:|:. ..:::|...:..||.||.|::           .|.:|::.    :.
  Rat   207 DKIKTSAGDKGVDVIIEM-LANKNLSNDLKLLSCGGRVIVVGCRGSIEINPRDTMAKETSIIGVS 270

  Fly   362 KFSRLSEQYQQEIIAISNGTAEQLAELVELVANKK-IEPPPHSVFPCEQAAEVIAKLCNS 420
            .||...|::|            |.|.:::....|. ::|...|.:|.|:||:....:.:|
  Rat   271 LFSSTKEEFQ------------QFAGILQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 74/301 (25%)
MDR 144..428 CDD:302572 74/299 (25%)
CryzNP_001012183.1 zeta_crystallin 8..329 CDD:176215 78/320 (24%)
Qor 8..327 CDD:223677 78/320 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.