DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and Vat1l

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_003751931.2 Gene:Vat1l / 361414 RGDID:1598315 Length:417 Species:Rattus norvegicus


Alignment Length:351 Identity:72/351 - (20%)
Similarity:133/351 - (37%) Gaps:109/351 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IREGS--------FFPGFEVAGVIESLGSEITEANNRGLRIGQRVIVYPFDETPAGYAELLVVPD 193
            :|:|:        ..||||.:|::|:||..:     :|..||.||:.:   .....:||::..| 
  Rat    85 VRQGNIDNPPKTPLVPGFECSGIVEALGDSV-----KGYEIGDRVMAF---VNYNAWAEVVCTP- 140

  Fly   194 LKHVVPIPDSLPMEVAAMLPTGALLAWNAVFK--------------AQAVVTQILSQRAATEPKR 244
            ::.|..|||.:....||..|...:.|:..:|:              |...|.|.::|..:|    
  Rat   141 VEFVYKIPDDMSFSEAAAFPMNFVTAYTMLFEIANLREGMSVLVHSAGGGVGQAVAQLCST---- 201

  Fly   245 KPKILIVGTGGLALWAVRIASYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEP 309
            .|.:.:.||.              :|...:.:..:|..|.|.......|:|.:|           
  Rat   202 VPNVTVFGTA--------------STFKHEAIKDSVTHLFDRNADYVQEVKRIS----------- 241

  Fly   310 QLIERTKDVCGGAVDVVID----------------------FGTTSR---------SLHRSMHCL 343
                      ...||:|:|                      :|:::.         |..:|...:
  Rat   242 ----------AEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGSSNMVTGETKSFFSFAKSWWQV 296

  Fly   344 SKGGVVLISDEVAEKLLPKFSRLSEQYQQEIIAISNGTAEQLAELVELVANKKIEPPPHSVFPCE 408
            .|...:.:.:|  .|::..||.|:..::|....:..|..|   :|:.|...|||:|...|::..|
  Rat   297 EKVNPIKLYEE--NKVIAGFSLLNLLFKQGRSGLIRGVVE---KLIGLYNQKKIKPVVDSLWALE 356

  Fly   409 QAAEVIAKLCNSEIPGRAILRFHDIE 434
            :..|.:.::.:....|:.||   |:|
  Rat   357 EVKEAMQRIHDRGNIGKLIL---DVE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 68/332 (20%)
MDR 144..428 CDD:302572 66/328 (20%)
Vat1lXP_003751931.2 MDR3 41..378 CDD:176236 70/348 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.