DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and Adh6a

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_006233433.3 Gene:Adh6a / 295498 RGDID:1310029 Length:375 Species:Rattus norvegicus


Alignment Length:438 Identity:86/438 - (19%)
Similarity:141/438 - (32%) Gaps:155/438 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QVSIESPGPGAKNCVFNFFVPIEDTPALGARIRIVCAGACYRRRDRANSITSMSSVSSELSDYCP 124
            :|.:|.|..|.                  .||:::.:|.|       .|...|  :..||....|
  Rat    26 EVQVEPPKSGE------------------VRIKMISSGIC-------GSDDHM--LKGELLANFP 63

  Fly   125 SVNSMSSPAHQGIREGSFFPGFEVAGVIESLGSEITEANNRGLRIGQRVI--------------- 174
            .:                 ||.|.||::||:|..:.     .::.|.:|:               
  Rat    64 LI-----------------PGHEGAGIVESVGDGVC-----SVKPGDKVLTLIIPQCRECDSCLH 106

  Fly   175 ----------VYP-----FDET---------------PAGYAELLVVPDLKHVVPIPDSLPMEVA 209
                      |.|     .|.|               .:.:.|..|||::. ||.|.|:.||:..
  Rat   107 LKGNFCEKQDVLPCSGVMLDGTSRFSCRGRKIYHSFRTSSFTEYTVVPEIA-VVKIDDAAPMDKV 170

  Fly   210 AMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKP--KILIVGTGGLALWAVRIASYHFATTG 272
            .::..|....:.|               |....|..|  ..::.|.||:....|....    .:|
  Rat   171 CLISCGFPTGYGA---------------AVNSAKVTPGSTCVVFGLGGVGSAIVMGCK----ASG 216

  Fly   273 ADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLIER-----TKDVCGGAVDVVID-FGT 331
            |..  |....:.::.|..|   :.:.|   .:|| .|:.:|:     .|::.|..||...: .|.
  Rat   217 ASR--IIGVDINEQKFPRA---RALGV---TDCL-NPKKLEKPVQEVVKEMTGVGVDFAFEAIGQ 272

  Fly   332 TSRSLHRSMHCLSKGGVVLISDEVAEKLLPKFSRLSEQYQQEIIAISNG------------TAEQ 384
            ..........|....||.||..     |.|..:.||    .|...|.:|            |.:.
  Rat   273 VDTMAAAWNSCNHSYGVCLIVG-----LAPSDTHLS----LEASKILSGKTLKGVCLGDYKTRDC 328

  Fly   385 LAELV-ELVANK-KIEPPPHSVFPCEQAAEVIAKLCNSEIPGRAILRF 430
            :.::| :.:.|| .|:|......|..|..:.: :|.:|....|.:|.|
  Rat   329 IPQIVTDYLQNKINIDPLVTHQLPFSQLHKAL-ELYHSGKTIRCVLLF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 72/354 (20%)
MDR 144..428 CDD:302572 71/350 (20%)
Adh6aXP_006233433.3 MDR 3..375 CDD:418376 85/436 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338827
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.