DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and Tp53i3

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_006250102.1 Gene:Tp53i3 / 289138 RGDID:1304982 Length:350 Species:Rattus norvegicus


Alignment Length:312 Identity:71/312 - (22%)
Similarity:125/312 - (40%) Gaps:72/312 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 FFPGFEVAGVIESLGSEITEANNRGLRIGQRVI-VYPFDETPAGYAELLVVPDLKHVVPIPDSLP 205
            |.||.|.:||:...|::::.     ::.|.||| |..|.    ..||..:. |.|.:..||:::.
  Rat    83 FTPGMEFSGVVLEAGADVST-----VKKGDRVIGVSNFH----SMAEQCIT-DQKTLWRIPENVS 137

  Fly   206 MEVAAMLPTG---ALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILIVGTGGLALWAVRIASYH 267
            ::.||:||..   |:||              :..||..:| .:..::....|...|..:.:|:..
  Rat   138 LQDAAVLPVSYGTAILA--------------VDHRARIQP-GETVLVTAAAGATGLAVIDVATNV 187

  Fly   268 FATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLIERTKDVCGGA-VDVVID--- 328
            |.      ..:..|:..||..:||.:....|.|.::    :..|.:..|.:.|.: |:|.||   
  Rat   188 FC------AKVIAAAGSDEKCKLAMQRGAQSGVNYS----QGSLKDAVKKLVGSSGVNVAIDMVG 242

  Fly   329 ---FGTTSRSLHRSMHCLSKGGVVLI---SDEVAE-----KLLPKFSRLS---EQYQQEIIAI-- 377
               |..:.|||      ..:|.:|::   ...:|.     .||...|.:.   .:||.:..|:  
  Rat   243 GDVFLDSLRSL------AWEGRIVVLGFAGGNIASVPSNLLLLKNISAMGLYWGRYQHQDFAVFS 301

  Fly   378 -SNGTAEQLAELVELVANKKIEPPPHSVFPCEQAAEVIAKLCNSEIPGRAIL 428
             |..||.|..:      ...|.|...:||..|:..:....:...:..|:.:|
  Rat   302 KSMSTALQYCQ------QGLIHPHTGAVFKLEKVNDAFLHVMQRKSTGKVLL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 71/312 (23%)
MDR 144..428 CDD:302572 69/308 (22%)
Tp53i3XP_006250102.1 QOR1 27..347 CDD:176203 70/310 (23%)
Qor 28..347 CDD:223677 70/310 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.