DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and Cryzl1

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001013062.1 Gene:Cryzl1 / 288256 RGDID:1310219 Length:348 Species:Rattus norvegicus


Alignment Length:325 Identity:74/325 - (22%)
Similarity:122/325 - (37%) Gaps:90/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 EGSFFP-GFEVAGVIESLGSEITEANNRGLRIGQRVIVYPFDETPAGYAELLVVPDLKHVVPIPD 202
            |..||| |.||||::..:|.:::........:|    :.|.|....|..|::.|.: .::|..|:
  Rat    56 EKEFFPVGREVAGIVLDVGKKVSFFQPDDEVVG----ILPLDSEDPGLCEVIRVQE-HYLVHKPE 115

  Fly   203 SLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILIVGTGGLALWAVRIASYH 267
            .:|...||.:....:.|:.|::        .|||.:    ..|..:::.|.......|:::|.:.
  Rat   116 KVPWTEAAGVIRDGVRAYTALY--------YLSQLS----PGKSVLIMDGASAFGTIAIQLAHHR 168

  Fly   268 FATTGADNVDITVASLRDEGF--RLATEIKNVSVVQWNECLYEPQLIERTKDVCGG-AVDVVIDF 329
            .|     .|..|..||.|:..  ||...:..|..|...:.    .:.||..:..|| .||:|||.
  Rat   169 GA-----KVISTAHSLEDKQHLERLRPSLARVIDVSSGKV----HVAERCLEETGGLGVDIVIDA 224

  Fly   330 G---------------------------------TTSRSLH---RSMHCLSKGG--VVLISDEVA 356
            |                                 ||..:|.   ...|||...|  |..::||| 
  Rat   225 GVRLYSKDDEPAVKQQLPHKHDIITLLSVGGHWITTEENLQLDPPDSHCLFLKGATVAFLNDEV- 288

  Fly   357 EKLLPKFSRLSEQYQQEIIAISNGTAEQLA-----ELVELVANKKIEPPPHSVFPCEQAAEVIAK 416
                   ..||...|.:.:.|.....|:|:     .|::       ||.|  ::..:.:.||:.|
  Rat   289 -------WNLSNAQQGKYLCILKDVMEKLSAGVFRPLLD-------EPIP--LYEAKVSMEVVQK 337

  Fly   417  416
              Rat   338  337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 73/322 (23%)
MDR 144..428 CDD:302572 71/320 (22%)
Cryzl1NP_001013062.1 Qor 1..325 CDD:223677 71/311 (23%)
enoyl_red 31..346 CDD:176179 74/325 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.