DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and Vat1

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001028855.1 Gene:Vat1 / 287721 RGDID:1308943 Length:404 Species:Rattus norvegicus


Alignment Length:319 Identity:64/319 - (20%)
Similarity:127/319 - (39%) Gaps:77/319 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PGFEVAGVIESLGSEITEANNRGLRIGQRVIVYPFDETPAGYAELLVVPDLKHVVPIPDSLPMEV 208
            ||.|.|||:.::|..:::.     :.|.||:|.   .....:.|.:.||..:..: :|:::..|.
  Rat   121 PGMEGAGVVVAVGEGVSDR-----KAGDRVMVL---NRSGMWQEEVTVPSAQTFL-MPEAMTFEE 176

  Fly   209 AAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKP--KILI-VGTGGLALWAVRIAS----- 265
            ||.|....:.|:..:|....:               :|  .:|: :..||:.:.|:::..     
  Rat   177 AAALLVNYITAYMVLFDFGNL---------------RPGHSVLVHMAAGGVGMAALQLCRTVENV 226

  Fly   266 YHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLIERTKDVCGGAVDVVID-F 329
            ..|.|..|...::    |::.|.        ...:.::...|    ::..|.:....||:|:| .
  Rat   227 TVFGTASASKHEV----LKENGV--------THPIDYHTTDY----VDEIKKISPKGVDIVMDPL 275

  Fly   330 GTTSRSLHRSMHCLSKGGVVLISDEVAEKLL-PK-------------FSRLSEQYQQEIIAIS-- 378
            |.:..:  :..|.|...|.| ::..:|..|. ||             ||..:.|..|...|:.  
  Rat   276 GGSDTA--KGYHLLKPMGKV-VTYGMANLLTGPKRNLMAMARTWWNQFSVTALQLLQANRAVCGF 337

  Fly   379 -----NGTAEQLA----ELVELVANKKIEPPPHSVFPCEQAAEVIAKLCNSEIPGRAIL 428
                 :|..|.::    .|:.|.....|:|...||:|.|:.|:.:.::...:..|:.:|
  Rat   338 HLGYLDGEVELVSRVVTHLLALYNQGHIKPRIDSVWPFEKVADAMRQMQEKKNIGKVLL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 64/319 (20%)
MDR 144..428 CDD:302572 63/317 (20%)
Vat1NP_001028855.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
MDR3 60..398 CDD:176236 64/319 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338831
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.