DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and SPBC1773.06c

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_595121.1 Gene:SPBC1773.06c / 2540139 PomBaseID:SPBC1773.06c Length:346 Species:Schizosaccharomyces pombe


Alignment Length:312 Identity:77/312 - (24%)
Similarity:129/312 - (41%) Gaps:57/312 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PGFEVAGVIESLGSEITEANNRGLRIGQRVIVYPF----DETPAGYA--------------ELLV 190
            ||.:.||:||.:|.::     .|...|..|:...|    |.||..:|              :..|
pombe    64 PGSDGAGIIEKVGEDV-----EGFEKGDSVVCNFFTNYLDGTPTDFATHSALGGTRDGCFQKYAV 123

  Fly   191 VPDLKH-VVPIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKP--KILIVG 252
            :|  .| :|..|.:|..|..|.||..|:.|||.:|             .:.|.:.||  .:|::|
pombe   124 LP--AHALVHAPKNLSFEEIATLPCAAVTAWNGLF-------------GSKEHQVKPGNNVLVLG 173

  Fly   253 TGGLALWAVRIASYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLIERTKD 317
            |||::.:|::.|.       |...::||.|..||....|.::.....:.:.:   .||.......
pombe   174 TGGVSTFALQFAL-------AAGANVTVTSSSDEKLEFAKKLGATHTINYKK---TPQWASPALK 228

  Fly   318 VCGG-AVDVVIDFGTTSRSLHRSMHCLSKGGVV-LISDEVAEKLLPKFSRLSEQY---QQEIIAI 377
            :..| ....||:.| ..::|.:|:.||:|.|:: :|....:|...|..:.:..|.   ...|..|
pombe   229 MTNGVGYHHVIEVG-GEKTLPQSIACLAKDGMISMIGFVASEGTTPNLTSIIGQILNRNANIRGI 292

  Fly   378 SNGTAEQLAELVELVANKKIEPPPHSVFPCEQAAEVIAKLCNSEIPGRAILR 429
            ..|:.....::|..:..|.|.|....|||.:|..|......:....|:.:|:
pombe   293 FVGSVSMFRDMVACIEAKDIHPVVDKVFPFDQLKEAYEYQWSQAHIGKVVLK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 77/312 (25%)
MDR 144..428 CDD:302572 76/309 (25%)
SPBC1773.06cNP_595121.1 Qor 4..345 CDD:223677 77/312 (25%)
MDR7 12..345 CDD:176237 77/312 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.