DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and sodh-2

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_505992.1 Gene:sodh-2 / 179628 WormBaseID:WBGene00010791 Length:351 Species:Caenorhabditis elegans


Alignment Length:423 Identity:72/423 - (17%)
Similarity:135/423 - (31%) Gaps:150/423 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RQVSIESPGPGAKNCVFNFFVPIEDTPALGARIRIVCAGACYRRRDRANSITSMSSVSS-----E 118
            ||||:..|               ::...|   ::|..:|.|:            |.:.:     |
 Worm    25 RQVSVPQP---------------QENELL---VKIEYSGICH------------SDLHTWEGDFE 59

  Fly   119 LSDYCPSVNSMSSPAHQGIREGSFFPGFEVAGVIESLGSEITEANNRGLRIGQRVIV-------- 175
            .:..||.:.                 |.|.||.:.::||::     :|..||.|..:        
 Worm    60 YASICPLIG-----------------GHEGAGTVVTIGSKV-----KGWNIGDRAGIKLINANCL 102

  Fly   176 ------------------YPFDETPAGYAELLVVPDLKHVVPIPDSLPMEVAAMLPTGALLAWNA 222
                              |..|. ...:.|.|.:.|: ..:.:.:...:..||.:..|.:.|:.:
 Worm   103 NCEYCKTGHEPLCDHIQNYGIDR-HGTFQEYLTIRDI-DAIKVSNDTNLAAAAPVLCGGVTAYKS 165

  Fly   223 VFKAQAVVTQILSQRAATEPKRKPKILIVGT---GGLALWAVRIASYHFATTGADNVDITVASLR 284
            : ||..|               ||..::|.|   |||..:.::.|.    ..|...|.:...|..
 Worm   166 L-KATNV---------------KPGQIVVLTGAGGGLGSFGIQYAK----AMGMRVVAVDHISKE 210

  Fly   285 DEGFRLATEIKNVSVVQWNECLYEPQLIERTKDVCGGAVDVVIDFGTTSRSLHRSMHCLSKGGVV 349
            |       ..:|:....:.:....|.::...:.:..|....|:.|....:.:..::..:.|.|.|
 Worm   211 D-------HCRNLGAEWFVDAFDTPDIVAHIRKLTNGGAHGVVSFAAAKKPMEYALEYVRKRGTV 268

  Fly   350 -----------------LISDEVAEKLLPKFSRLSEQYQQEIIAISNGTAEQLAELVELVANKKI 397
                             ||.:|:..|.....||:  ...:.|..|:.|......|||:|      
 Worm   269 VFVGLPKDGTIPLDTLSLICNEITVKGSIVGSRM--DVDEAIDFITRGIVHVPIELVKL------ 325

  Fly   398 EPPPHSVFPCEQAAEVIAKLCNSEIPGRAILRF 430
                      |....|..::.:.::..|.::.|
 Worm   326 ----------EDVPSVYQRMKDGKVTSRVVVDF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 58/333 (17%)
MDR 144..428 CDD:302572 58/329 (18%)
sodh-2NP_505992.1 AdhP 7..349 CDD:223992 72/423 (17%)
CAD3 10..348 CDD:176257 71/421 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D771875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.