DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and Adh7

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_599156.2 Gene:Adh7 / 171178 RGDID:621638 Length:374 Species:Rattus norvegicus


Alignment Length:274 Identity:55/274 - (20%)
Similarity:87/274 - (31%) Gaps:86/274 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SFFP---GFEVAGVIESLGSEITEANNRGLRIGQRVI---------------------------- 174
            |.||   |.|..|::||:|.|:|.     :|.|.:||                            
  Rat    60 SKFPVIVGHEAVGIVESVGEEVTT-----VRPGDKVIPLFLPQCRECNPCRNPEGNLCIRSDLTG 119

  Fly   175 -----------------VYPFDETPAGYAELLVVPDLKHVVPIPDSLPMEVAAMLPTGALLAWNA 222
                             |..|..| :.:.|..|: |...|..|....|.|.|.::..|....:.|
  Rat   120 RGVLADGTTRFTCKDKPVQHFMNT-STFTEYTVL-DESSVAKIDAEAPPEKACLIGCGFSTGYGA 182

  Fly   223 VFKAQAVVTQILSQRAATEPKRKPKILIVGTGGLALWAVRIASYHFATTGADNVDITVASLRDEG 287
            ..|.           |...|  .....:.|.||:.|..|....    ..||..: |.:...:|: 
  Rat   183 AVKT-----------AKVSP--GSTCAVFGLGGVGLSVVMGCK----AAGASRI-IGIDINKDK- 228

  Fly   288 FRLATEIKNVSVVQWNECL----YEPQLIERTKDVCGGAVDVVID-FGTTSRSLHRSMHC-LSKG 346
            |:.|.:      |...||:    :...:.|...|:.|..|....: .|.....:.....| ::.|
  Rat   229 FQKALD------VGATECINPRDFTKPISEVLSDMTGNTVQYTFEVIGRLETMVDALSSCHMNYG 287

  Fly   347 GVVLISDEVAEKLL 360
            ..|::....:.|:|
  Rat   288 TSVVVGAPPSAKML 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 54/273 (20%)
MDR 144..428 CDD:302572 53/271 (20%)
Adh7NP_599156.2 alcohol_DH_class_I_II_IV 3..374 CDD:176259 55/274 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.