DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and CRYZ

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001123514.1 Gene:CRYZ / 1429 HGNCID:2419 Length:329 Species:Homo sapiens


Alignment Length:326 Identity:76/326 - (23%)
Similarity:130/326 - (39%) Gaps:74/326 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 SPAHQGIREGS--------FFPGFEVAGVIESLGSEITEANNRGLRIGQRVIVYPFDETPAGYAE 187
            :|....||.|:        :.||.:||||||::|.     |....:.|.|  |:.......||||
Human    48 NPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGD-----NASAFKKGDR--VFTSSTISGGYAE 105

  Fly   188 LLVVPDLKHVV-PIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILIV 251
            ..:..|  |.| .:|:.|..:..|.:......|:.|:..:..|             |....:|:.
Human   106 YALAAD--HTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACV-------------KAGESVLVH 155

  Fly   252 G-TGGLALWAVRIA-SYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNECLYEPQLIER 314
            | :||:.|.|.:|| :|.....|....        :||.::..:.....|....|..|    |::
Human   156 GASGGVGLAACQIARAYGLKILGTAGT--------EEGQKIVLQNGAHEVFNHREVNY----IDK 208

  Fly   315 TKDVCG-GAVDVVIDFGTTSRSLHRSMHCLSKGG-VVLISDEVAEKLLPK--------------F 363
            .|...| ..:|::|:. ..:.:|.:.:..||.|| |:::......::.|:              |
Human   209 IKKYVGEKGIDIIIEM-LANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLF 272

  Fly   364 SRLSEQYQQEIIAISNGTAEQLAELVELVANKKIEPPPHSVFPCEQAAEVIAKLCN-SEIPGRAI 427
            |...|::||...|:..|        :|:   ..::|...|.:|.|:.||....:.: |...|:.|
Human   273 SSTKEEFQQYAAALQAG--------MEI---GWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMI 326

  Fly   428 L 428
            |
Human   327 L 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 72/307 (23%)
MDR 144..428 CDD:302572 70/303 (23%)
CRYZNP_001123514.1 zeta_crystallin 8..329 CDD:176215 76/326 (23%)
Qor 8..327 CDD:223677 74/324 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.