DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and ADH7

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001159976.1 Gene:ADH7 / 131 HGNCID:256 Length:394 Species:Homo sapiens


Alignment Length:325 Identity:67/325 - (20%)
Similarity:106/325 - (32%) Gaps:115/325 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RIRIVCAGACYRRRDRANSITSMSSVSSELSDYCPSVNSMSSPAHQGIREGSFFP---GFEVAGV 151
            ||:|:..|.| |..|.....|.:|.                            ||   |.|..|:
Human    58 RIKILATGIC-RTDDHVIKGTMVSK----------------------------FPVIVGHEATGI 93

  Fly   152 IESLGSEIT-----------------EAN-------NRGLR---IGQRVI-------------VY 176
            :||:|..:|                 |.|       |..:|   .|:.|:             |:
Human    94 VESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGTTRFTCKGKPVH 158

  Fly   177 PFDETPAGYAELLVVPDLKHVVPIPDSLPMEVAAMLPTGALLAWNAVFKAQAVVTQILSQRAATE 241
            .|..| :.:.|..|| |...|..|.|:.|.|...::..|....:.|..|...|            
Human   159 HFMNT-STFTEYTVV-DESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKV------------ 209

  Fly   242 PKRKP--KILIVGTGGLALWAVRIASYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNE 304
               ||  ..::.|.||:.|..:....    :.||..: |.:...:|       :.:....|...|
Human   210 ---KPGSTCVVFGLGGVGLSVIMGCK----SAGASRI-IGIDLNKD-------KFEKAMAVGATE 259

  Fly   305 CLYEPQ---------LIERTKDVCGGAVDVVIDFGTTSRSLHRSMHCLSKGGVVLISDEVAEKLL 360
            |: .|:         |.|.|.:..|...:|:....|...:| .|.| ::.|..|::....:.|:|
Human   260 CI-SPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDAL-ASCH-MNYGTSVVVGVPPSAKML 321

  Fly   361  360
            Human   322  321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 58/273 (21%)
MDR 144..428 CDD:302572 57/271 (21%)
ADH7NP_001159976.1 alcohol_DH_class_I_II_IV 27..394 CDD:176259 67/325 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.