DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and ADH6

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:NP_001095940.1 Gene:ADH6 / 130 HGNCID:255 Length:375 Species:Homo sapiens


Alignment Length:310 Identity:58/310 - (18%)
Similarity:92/310 - (29%) Gaps:110/310 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PGAKNCVFNFFVPIEDTPALGARIRIVCAGACYRRRDRANSITSMSSVSSELSDYCPSVNSMSSP 132
            |||...:..  |.:....|...||::|..|.|.         |.|..:.|:..|.          
Human    18 PGAPFSIEE--VEVAPPKAKEVRIKVVATGLCG---------TEMKVLGSKHLDL---------- 61

  Fly   133 AHQGIREGSFFP---GFEVAGVIESLGSEITEANNRGLRIGQRVI-------------------- 174
                     .:|   |.|.||::||:|..::.     ::.|.:||                    
Human    62 ---------LYPTILGHEGAGIVESIGEGVST-----VKPGDKVITLFLPQCGECTSCLNSEGNF 112

  Fly   175 -------------------------VYPFDETPAGYAELLVVPDLKHVVPIPDSLPMEVAAMLPT 214
                                     :|.|..| :.:.|..|:.::. |..|....|:|...::..
Human   113 CIQFKQSKTQLMSDGTSRFTCKGKSIYHFGNT-STFCEYTVIKEIS-VAKIDAVAPLEKVCLISC 175

  Fly   215 GALLAWNAVFKAQAVVTQILSQRAATEPKRKPKILIVGTGGLALWAVRIASYHFATTGADNVDIT 279
            |....:.|......|..      .:|       ..:.|.||:.|..|      .....|....|.
Human   176 GFSTGFGAAINTAKVTP------GST-------CAVFGLGGVGLSVV------MGCKAAGAARII 221

  Fly   280 VASLRDEGFRLATEIKNVSVVQWNECLYEPQLIERTKDVCGGAVDVVIDF 329
            ...:..|.|:.|.|:..      .|||....|.:..::|.....|..|||
Human   222 GVDVNKEKFKKAQELGA------TECLNPQDLKKPIQEVLFDMTDAGIDF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 44/236 (19%)
MDR 144..428 CDD:302572 44/234 (19%)
ADH6NP_001095940.1 alcohol_DH_class_I_II_IV 3..375 CDD:176259 58/310 (19%)
FrmA 8..373 CDD:223990 58/310 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.