DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and LOC101884755

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_005173854.2 Gene:LOC101884755 / 101884755 -ID:- Length:356 Species:Danio rerio


Alignment Length:297 Identity:62/297 - (20%)
Similarity:107/297 - (36%) Gaps:90/297 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LGARIRIV-CAGACYRRRD-RANSITSMSSVSSELSDYCPSVNSMS---SPAHQGIREGSF---- 142
            ||.|..|. |:...||... ..|::.........:.|:...|..::   :||...:.:||:    
Zfish    16 LGQRRHIQHCSALVYREHSHNINTVRMEQLPLPPVGDHSVKVRMLAAPVNPADINMIQGSYPILC 80

  Fly   143 -FP---GFEVAGVIESLGSEITEANNRGLRIGQRVIVYPFDETPAGYA--ELLVVPDLKHVVPIP 201
             .|   |.|..|.:..:||::|     .||.|..|:  |.|   ||:.  ....|.:...::.||
Zfish    81 PIPAVGGNEGVGEVLEVGSDVT-----SLRPGDWVV--PID---AGFGTWRTAAVCEEDELISIP 135

  Fly   202 DSLPMEVAAMLPTGALLAWNAVFKAQAV-----VTQILSQRAATEPKRKPKILIVGTGGLALWAV 261
            ..:.:..||.:......|:..:...|.:     |.|..|..|            ||..     .:
Zfish   136 KDISVLGAATIFVNPCTAYRMLHDFQTLSPGNTVIQNASNSA------------VGQA-----VI 183

  Fly   262 RIASYHFATTGADNVDITVASLRDEGFRLATEIKNVSVVQWNE-CLYEPQLIERTKDVCGGAVDV 325
            :||:                         |..:|.:::::..| |   .||::..:.:  ||..|
Zfish   184 QIAA-------------------------ALGLKTINIIRDRENC---DQLMQELQSL--GADYV 218

  Fly   326 VIDFGTTSRSLHR----------SMHCLS--KGGVVL 350
            |.:....|..||:          .::|:.  .||:||
Zfish   219 VTEEEVMSSGLHQLFEEVPKPKLGLNCVGGLSGGLVL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 48/237 (20%)
MDR 144..428 CDD:302572 48/230 (21%)
LOC101884755XP_005173854.2 ETR 25..356 CDD:176250 58/288 (20%)
Qor 27..356 CDD:223677 57/286 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0604
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.