DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drat and adh7

DIOPT Version :9

Sequence 1:NP_610293.3 Gene:Drat / 35687 FlyBaseID:FBgn0033188 Length:434 Species:Drosophila melanogaster
Sequence 2:XP_002934814.1 Gene:adh7 / 100487608 XenbaseID:XB-GENE-6032700 Length:373 Species:Xenopus tropicalis


Alignment Length:396 Identity:77/396 - (19%)
Similarity:123/396 - (31%) Gaps:170/396 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IEDTP--ALGARIRIVCAGACYRRRDRANSITSMSSVSSELSDYCPSVNSMSSPAHQGIREGSF- 142
            ||..|  |...||:::..|.|   |...:|:                             ||.| 
 Frog    27 IEVAPPKAHEVRIKLIATGIC---RSDDHSL-----------------------------EGKFA 59

  Fly   143 ---FP---GFEVAGVIESLGSEITEANNRGLRIGQRVI--------------------------- 174
               ||   |.|..|::||:|..:     :.::.|.:||                           
 Frog    60 AVKFPVILGHEGVGIVESIGDGV-----KDIKPGDKVIPLVAPQCGKCQCCKDPRTNRCLTRLKR 119

  Fly   175 ------------------VYPFDETPAGYAELLVVPDLKHVVPIPDSLPMEVAAMLPTGALLAWN 221
                              :|.|..| :.:.|..||.::. |..|.|:..|:...::..|....:.
 Frog   120 QFGLMSDGTSRFTCRGKQIYHFMNT-STFTEYTVVEEMA-VAKIDDNATMDSVCLIGCGFSTGYG 182

  Fly   222 AVFKAQAVVTQILSQRAATEPKRKPKILIVGTGGLALWAV---RIASYHFATTGADNVDITVASL 283
            :....           |...|  :....|.|.||:.|..:   :||       ||  ..|....:
 Frog   183 SALNT-----------AKVHP--ESTCAIFGLGGIGLAVIMGCKIA-------GA--ARIIGVDI 225

  Fly   284 RDEGFRLATEIKNVSVVQWNECLYEPQLIERTKDVCGGAVDVVID------------------FG 330
            ..:.|.:|.|:.....:..|:  |:..:.|...:..||.||...:                  ||
 Frog   226 NPDKFDIAKELGATECINPND--YDKPVAEMILEQTGGGVDYAFECVGHAETMLAALHSSHFAFG 288

  Fly   331 TT-----SRSL----------HRSMHCLSKGG-------VVLISDEVAEKL---------LPKFS 364
            ||     |.|.          .|::...|.||       ..|:||.:|:|.         || |.
 Frog   289 TTVIIGASASTLSFDPMILLSGRTLKSSSFGGWKSRLEVPKLVSDYLAKKFDLEKLVTHRLP-FQ 352

  Fly   365 RLSEQY 370
            ::||.:
 Frog   353 KISEGF 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DratNP_610293.3 Qor 142..430 CDD:223677 65/333 (20%)
MDR 144..428 CDD:302572 63/327 (19%)
adh7XP_002934814.1 alcohol_DH_class_I_II_IV 3..373 CDD:176259 77/396 (19%)
FrmA 8..373 CDD:223990 77/396 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D771875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.