DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-G and Enpp4

DIOPT Version :9

Sequence 1:NP_610292.2 Gene:PIG-G / 35685 FlyBaseID:FBgn0033187 Length:927 Species:Drosophila melanogaster
Sequence 2:XP_006524196.1 Gene:Enpp4 / 224794 MGIID:2682634 Length:470 Species:Mus musculus


Alignment Length:350 Identity:81/350 - (23%)
Similarity:119/350 - (34%) Gaps:111/350 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LLLV--DALRDDFPDATSMPVAYSRACEKLKL-HVD--IPTVTMPRLKSITTGTLSNFIDIALNV 127
            ||||  |..|.|:..:..:|...:...|.:.: ||.  ..|.|.|...||.||.......|..| 
Mouse    45 LLLVSFDGFRADYLKSYDLPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVAN- 108

  Fly   128 GHTEQMQDSFLHR-LKQQNRVVSF---AGDHTWVKLFPSEFTRQVEN----------------HD 172
                .|.||...: ..:.|....|   ..:..||       |.|::.                |:
Mouse   109 ----SMYDSVTKKHFSESNDKDPFWWNGAEPIWV-------TNQLQENRSSAAAMWPGTDVPIHN 162

  Fly   173 ---SFYVN-----DFYEGDRNVTKTLETELERSDWSLLILHYLGLDHIGHVEGNASP----RVPL 225
               |:::|     .|.|...|||..|.:  .....:...|::...|..||..|....    ||  
Mouse   163 ITASYFMNYSSSVSFKERLGNVTTWLSS--SNPPVTFAALYWEEPDVSGHKYGPEDKENMRRV-- 223

  Fly   226 KLKEMDEVV------KKILDHKSFPNVLLMLTGDHGMADGGGHGGNTPAETLVPLYLYYNNCSKT 284
             |||:|:::      .|:|......||:  :|.|||||                      .|||.
Mouse   224 -LKEVDDLIGDIVLKLKVLGLWDSLNVI--ITSDHGMA----------------------QCSKN 263

  Fly   285 -----PSASKR--YNQIDLAPTLSVLLSVEIPTL--SIGCLIPEMLQSLSLEHQLYAYFYNAHH- 339
                 .|...|  |:.|||.|..::|..:.:..:  .:....|.|  ::.|:..:...||..|. 
Mouse   264 RLIDLDSCIDRSNYSVIDLTPVAAILPKINVTEVYDKLKRCNPHM--NVYLKEAIPNRFYYQHSS 326

  Fly   340 ---------------LLNKARVKFG 349
                           .|||:..|.|
Mouse   327 RIQPIILVAEEGWTITLNKSSFKLG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-GNP_610292.2 GPI_EPT_2 60..317 CDD:293748 70/300 (23%)
Enpp4XP_006524196.1 Enpp 43..396 CDD:293742 80/349 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.