DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-G and ENPP6

DIOPT Version :9

Sequence 1:NP_610292.2 Gene:PIG-G / 35685 FlyBaseID:FBgn0033187 Length:927 Species:Drosophila melanogaster
Sequence 2:NP_699174.1 Gene:ENPP6 / 133121 HGNCID:23409 Length:440 Species:Homo sapiens


Alignment Length:250 Identity:56/250 - (22%)
Similarity:95/250 - (38%) Gaps:59/250 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LGMELTPPPPAYDSFVLLLVDALRDDF---PDATSMP---VAYSRACEKLKLHVDIPTVTMPRLK 110
            |.:.|..|..|....::.|:|..|.|:   ....|:|   ...||..:...|..|.|:::.|...
Human    12 LALGLAQPASARRKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYPNYY 76

  Fly   111 SITTG----------------TLSNFIDIALNVGHTEQMQDS------------FLHRLKQQNRV 147
            ::.||                |.:...||.:|       :||            ::...|.:.:|
Human    77 TLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVN-------KDSLMPLWWNGSEPLWVTLTKAKRKV 134

  Fly   148 VSFAGDHTWVKLFPSEFTRQVENHDSFYVNDFYEGDRNVTKTLETELE-----RSDWSLLILHYL 207
            ..:......|::.....|..:|     |.|  ...|.|....:...|:     |:|  |..:::.
Human   135 YMYYWPGCEVEILGVRPTYCLE-----YKN--VPTDINFANAVSDALDSFKSGRAD--LAAIYHE 190

  Fly   208 GLDHIGHVEGNASPRVPLKLKEMDEVVK---KILDHKSFPNVL-LMLTGDHGMAD 258
            .:|..||..|.|||:....||.:|.|:|   |.:..:...:.| :::..||||.|
Human   191 RIDVEGHHYGPASPQRKDALKAVDTVLKYMTKWIQERGLQDRLNVIIFSDHGMTD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-GNP_610292.2 GPI_EPT_2 60..317 CDD:293748 52/241 (22%)
ENPP6NP_699174.1 Enpp 24..397 CDD:293742 51/237 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.