| Sequence 1: | NP_610291.2 | Gene: | CG1602 / 35684 | FlyBaseID: | FBgn0033186 | Length: | 577 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021327400.1 | Gene: | znf1001 / 798047 | ZFINID: | ZDB-GENE-080213-7 | Length: | 337 | Species: | Danio rerio |
| Alignment Length: | 246 | Identity: | 84/246 - (34%) |
|---|---|---|---|
| Similarity: | 117/246 - (47%) | Gaps: | 22/246 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 327 LRQWYYKN-----TKHAIYAGSTAEKFYLEVCRFMPAKMYKQRL-------VCEFCHQITSSDHV 379
Fly 380 LQSHIFKAHNIGELPFKCTLCDRSFVGRCELANHIQRVHIG-KTHKCTHCERSFAVMSDLQLHIR 443
Fly 444 THTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRAFKCTMCPKDFVKKVDLSDHIKGHLNIRDK 508
Fly 509 ICSVCGKGFTSCHALIRHRQIHSEVKKFVCKLCDSRFSQFVGLNTHMKRTH 559 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1602 | NP_610291.2 | GT1 | 157..244 | CDD:304916 | |
| MADF_DNA_bdg | 273..356 | CDD:287510 | 11/33 (33%) | ||
| C2H2 Zn finger | 367..388 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 397..418 | CDD:275368 | 6/20 (30%) | ||
| COG5048 | <423..554 | CDD:227381 | 52/130 (40%) | ||
| C2H2 Zn finger | 425..445 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 437..460 | CDD:290200 | 14/22 (64%) | ||
| C2H2 Zn finger | 453..470 | CDD:275368 | 5/16 (31%) | ||
| C2H2 Zn finger | 482..502 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 510..530 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 538..559 | CDD:275368 | 10/20 (50%) | ||
| znf1001 | XP_021327400.1 | COG5048 | 27..327 | CDD:227381 | 83/244 (34%) |
| C2H2 Zn finger | 27..47 | CDD:275368 | |||
| C2H2 Zn finger | 55..75 | CDD:275368 | |||
| C2H2 Zn finger | 83..103 | CDD:275368 | 4/11 (36%) | ||
| C2H2 Zn finger | 111..131 | CDD:275368 | 5/23 (22%) | ||
| C2H2 Zn finger | 139..159 | CDD:275368 | 5/21 (24%) | ||
| C2H2 Zn finger | 167..187 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 195..215 | CDD:275368 | 7/19 (37%) | ||
| SFP1 | <222..323 | CDD:227516 | 37/101 (37%) | ||
| C2H2 Zn finger | 223..243 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 251..271 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 279..299 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 307..327 | CDD:275368 | 10/20 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24393 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||