DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and ZNF711

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:XP_011529321.1 Gene:ZNF711 / 7552 HGNCID:13128 Length:811 Species:Homo sapiens


Alignment Length:616 Identity:127/616 - (20%)
Similarity:216/616 - (35%) Gaps:173/616 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EDDFEPVG-----ENSTESGH-----VDPPEEKPQAEESIFQQDESADGACVQLHIDAVRSSTNE 104
            |||.|..|     |:...|||     :|  :.:.|.|:.::.               ||:.|:.|
Human   258 EDDVEIGGTEIVTESEYTSGHSVAGVLD--QSRMQREKMVYM---------------AVKDSSQE 305

  Fly   105 TEESDVSLVTDE---EESVQDEDPS---EPALDDANLKTTPTYKFHPSFFRRDHRTIKFIEIYKE 163
            .::...:.:.||   |..|.:|:.:   |..|:|:::..|..                       
Human   306 EDDISCAEIADEVYMEVIVGEEEGTSLPEIQLEDSDVNKTVV----------------------- 347

  Fly   164 HPCLWNPAHSDYKEPKK----CKEALKRMAIDLE---ATVSVFL--------NEMALKLAIKKVH 213
             |.:|..|:.|.:...:    |:.:...:...||   :|.:.:|        |::..:.|.|:..
Human   348 -PVVWAAAYGDERRVSRRYEDCQASGNTLDSALESRSSTAAQYLQICDGINTNKVLKQKAKKRRR 411

  Fly   214 MQFNTVHKRVVSG----------------------------KQKPQSLAFSIYKL--CCFLNASN 248
            .:.......|:.|                            |..|..|....|:.  |.|     
Human   412 GETRQWQTAVIIGPDGQPLTVYPCHICTKKFKSRGFLKRHMKNHPDHLMRKKYQCTDCDF----- 471

  Fly   249 DEEGATNNEKIKLDFSKKNKLTTDLIEMYANFPQLYDSNHKEFSNMSSRKQA------------- 300
                 |.|:|:......::....:.::....|.: |...::|.|.:||.|..             
Human   472 -----TTNKKVSFHNHLESHKLINKVDKTHEFTE-YTRRYREASPLSSNKLILRDKEPKMHKCKY 530

  Fly   301 --YESMAAEISVPNVDINSDDIFRAIQNLRQWYYKNTKHAIYAGSTAEKFYLEVCRFMPAKMYKQ 363
              ||:  ||..:.|            ::|...:.||..|.........:...|:.:.|.....::
Human   531 CDYET--AEQGLLN------------RHLLAVHSKNFPHVCVECGKGFRHPSELKKHMRTHTGEK 581

  Fly   364 RLVCEFCHQITSSDHVLQSHIFKAHNIGELPFKCTLCDRSFVGRCELANHIQRVHIGKTHKCTHC 428
            ...|::|....:....|::||...|. ..||:||..|.::|....||..|:......|||:|.||
Human   582 PYQCQYCIFRCADQSNLKTHIKSKHG-NNLPYKCEHCPQAFGDERELQRHLDLFQGHKTHQCPHC 645

  Fly   429 ERSFAVMSDLQLH-IRTHTGHKPYVCEHCGKAFRLRSQ--------------------------- 465
            :......|||:.| |..||...|:.||.|.|.|...|:                           
Human   646 DHKSTNSSDLKRHIISVHTKDFPHKCEVCDKGFHRPSELKKHSDIHKGRKIHQCRHCDFKTSDPF 710

  Fly   466 -MTLHVTAIHTKIRAFKCTMCPKDFVKKVDLSDHIKGHLNIRDKICSVCGKGFTSCHALIRH-RQ 528
             ::.|:.::|||.:..||..|.:.|.::.:|..|:|.|...:...|..|....|......|| ..
Human   711 ILSGHILSVHTKDQPLKCKRCKRGFRQQNELKKHMKTHTGRKIYQCEYCEYSTTDASGFKRHVIS 775

  Fly   529 IHSEVKKFVCKLCDSRFSQFVGLNTHMKRTH 559
            ||::.....|:.|...|.:....|.|:.|.|
Human   776 IHTKDYPHRCEFCKKGFRRPSEKNQHIMRHH 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 19/131 (15%)
MADF_DNA_bdg 273..356 CDD:287510 17/97 (18%)
C2H2 Zn finger 367..388 CDD:275368 5/20 (25%)
C2H2 Zn finger 397..418 CDD:275368 6/20 (30%)
COG5048 <423..554 CDD:227381 41/160 (26%)
C2H2 Zn finger 425..445 CDD:275368 8/20 (40%)
zf-H2C2_2 437..460 CDD:290200 11/23 (48%)
C2H2 Zn finger 453..470 CDD:275368 6/44 (14%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 5/20 (25%)
C2H2 Zn finger 538..559 CDD:275368 6/20 (30%)
ZNF711XP_011529321.1 Zfx_Zfy_act 69..418 CDD:282547 37/200 (19%)
COG5048 <426..604 CDD:227381 32/202 (16%)
zf-C2H2 433..455 CDD:278523 1/21 (5%)
C2H2 Zn finger 435..455 CDD:275368 1/19 (5%)
C2H2 Zn finger 528..549 CDD:275368 6/34 (18%)
COG5048 550..>807 CDD:227381 66/258 (26%)
zf-C2H2 555..577 CDD:278523 3/21 (14%)
C2H2 Zn finger 557..577 CDD:275368 2/19 (11%)
zf-H2C2_2 569..593 CDD:290200 4/23 (17%)
C2H2 Zn finger 585..606 CDD:275368 5/20 (25%)
C2H2 Zn finger 614..640 CDD:275368 7/25 (28%)
C2H2 Zn finger 642..663 CDD:275368 8/20 (40%)
C2H2 Zn finger 671..720 CDD:275368 7/48 (15%)
C2H2 Zn finger 728..748 CDD:275368 6/19 (32%)
zf-H2C2_2 740..764 CDD:290200 6/23 (26%)
C2H2 Zn finger 756..777 CDD:275368 5/20 (25%)
C2H2 Zn finger 785..805 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.