DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and CG12071

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster


Alignment Length:352 Identity:73/352 - (20%)
Similarity:113/352 - (32%) Gaps:132/352 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 NFPQLYDSNHKEFS-NMSSRKQAYESM-------------AAEISVPNVDINS------------ 317
            |.|...::|:.:.: ||..::|..:..             ||.|.||.:..::            
  Fly    40 NSPTANNNNNSQNNGNMQQQQQQQQQQQQQQQQQQQQQHYAATIKVPQISSSNVAAAAAGESTFT 104

  Fly   318 --DDIF------RAIQNLRQWYYKNTKHAIYAGSTAEKF---------------YLEVCRFMPAK 359
              ||..      |.:|:|..|            |.||:.               |:|.....||.
  Fly   105 VPDDGMGFEGGVRVLQSLGTW------------SAAEQLTYNIPKPNLIPFTEPYVEGGSMHPAS 157

  Fly   360 MYKQRLVCEFCHQITSSDHVLQSHIFKAHNIGELPFKCTLCDRSFVGRCELANHIQRVHIGKTHK 424
            ..|.      ..|:..:    .|.:.|.:     |.|.|                     .|..:
  Fly   158 RLKA------LQQVQQA----SSGVRKTN-----PSKST---------------------NKAFE 186

  Fly   425 CTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRAFK----CTMC 485
            ||.|.:..|....|.:|:|.|||.|||:||.|.|||..|.::.:|       :..||    ..:.
  Fly   187 CTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKAFARRDKLVIH-------MNKFKHVTPTNIA 244

  Fly   486 P-----KDFVKKVDLSD------HIKGHLNIRDKICSVCGKGFTSCHA----------LIRHRQI 529
            |     .:.|||.:..|      .....|.::.:...|..:......|          :|.|   
  Fly   245 PLGKRLNNMVKKKEQPDPPPEDNKQSLELQLQQQAVQVAAQNIIVQSAQGAPTSIPGIIIPH--- 306

  Fly   530 HSEVKKFVCKLCDSRFSQFVGLNTHMK 556
            |.:...:.|:||...||.....:.|.|
  Fly   307 HQQQLSWTCELCGRMFSSRDEWSIHAK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916
MADF_DNA_bdg 273..356 CDD:287510 22/125 (18%)
C2H2 Zn finger 367..388 CDD:275368 3/20 (15%)
C2H2 Zn finger 397..418 CDD:275368 1/20 (5%)
COG5048 <423..554 CDD:227381 39/155 (25%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..460 CDD:290200 13/22 (59%)
C2H2 Zn finger 453..470 CDD:275368 7/16 (44%)
C2H2 Zn finger 482..502 CDD:275368 5/30 (17%)
C2H2 Zn finger 510..530 CDD:275368 4/29 (14%)
C2H2 Zn finger 538..559 CDD:275368 7/19 (37%)
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 7/21 (33%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
zf-H2C2_2 200..224 CDD:290200 15/23 (65%)
C2H2 Zn finger 215..232 CDD:275368 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.