powered by:
Protein Alignment CG1602 and CG4374
DIOPT Version :9
Sequence 1: | NP_610291.2 |
Gene: | CG1602 / 35684 |
FlyBaseID: | FBgn0033186 |
Length: | 577 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262874.1 |
Gene: | CG4374 / 42767 |
FlyBaseID: | FBgn0039078 |
Length: | 772 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 20/47 - (42%) |
Similarity: | 29/47 - (61%) |
Gaps: | 0/47 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 423 HKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLH 469
|.|:.|.:.|.....:.:|||||||.||:.|..|||:||.::.:..|
Fly 649 HYCSICAKGFKDKYSVNVHIRTHTGEKPFACSLCGKSFRQKAHLAKH 695
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR24393 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.