DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1602 and CG4374

DIOPT Version :9

Sequence 1:	NP_610291.2	Gene:	CG1602 / 35684	FlyBaseID:	FBgn0033186	Length:	577	Species:	Drosophila melanogaster
Sequence 2:	NP_001262874.1	Gene:	CG4374 / 42767	FlyBaseID:	FBgn0039078	Length:	772	Species:	Drosophila melanogaster

Alignment Length:	47	Identity:	20/47 - (42%)
Similarity:	29/47 - (61%)	Gaps:	0/47 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   423 HKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLH 469
            |.|:.|.:.|.....:.:|||||||.||:.|..|||:||.::.:..|
  Fly   649 HYCSICAKGFKDKYSVNVHIRTHTGEKPFACSLCGKSFRQKAHLAKH 695

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1602	NP_610291.2	GT1	157..244	CDD:304916
		MADF_DNA_bdg	273..356	CDD:287510
		C2H2 Zn finger	367..388	CDD:275368
		C2H2 Zn finger	397..418	CDD:275368
		COG5048	<423..554	CDD:227381	20/47 (43%)
		C2H2 Zn finger	425..445	CDD:275368	6/19 (32%)
		zf-H2C2_2	437..460	CDD:290200	13/22 (59%)
		C2H2 Zn finger	453..470	CDD:275368	7/17 (41%)
		C2H2 Zn finger	482..502	CDD:275368
		C2H2 Zn finger	510..530	CDD:275368
		C2H2 Zn finger	538..559	CDD:275368
CG4374	NP_001262874.1	zf-C2H2	649..671	CDD:278523	7/21 (33%)
		C2H2 Zn finger	651..671	CDD:275370	6/19 (32%)
		zf-H2C2_2	663..688	CDD:290200	14/24 (58%)
		C2H2 Zn finger	679..699	CDD:275370	7/17 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24393
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100