DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and CG6791

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster


Alignment Length:706 Identity:128/706 - (18%)
Similarity:217/706 - (30%) Gaps:267/706 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RCSYCPTDVEVAQWQEFVLHIRNVH--SKVRSMEDDFEPVGENSTESGHVDPPEEKPQAEESIFQ 81
            :|..|..:.:..  |:.::|:|.||  ..|..|.:.:...|             .|.:..||..:
  Fly   237 KCYICKREYKYR--QDLMVHLRMVHCDEVVAMMREGYNAAG-------------RKTRVRESRTE 286

  Fly    82 QDESADGACVQLHIDAVRSSTNETEESDVSLVTDE-------EESVQDEDPSEPALDDANLKTTP 139
            |         .|...:.|.:.:..||||...|.:|       |...|::..||    :.:.|...
  Fly   287 Q---------LLREKSFRENDDLGEESDRIEVRNELLEPDADESGTQEQTVSE----EVSKKKAG 338

  Fly   140 TYKFHPSFFRRDHRTIKFIEIYKEHPC-----------LWNPAHSDYKEPKKCKEALKRMAIDLE 193
            |           ....:..|.|..:.|           .|: .|.::......:..|...::|::
  Fly   339 T-----------RGAAELCEDYIHYMCPDCGTDCDTHAQWS-QHIEFVHDYVSRRGLNFRSVDMQ 391

  Fly   194 ATVSVFLNEMALKLAIKKVHMQFNTV-----HKRVVSGKQKPQSLAFSIYKLCCFLNASNDEEGA 253
            ...          |..||: :..||:     ||  .|...:|:.|.   .|||        .:|.
  Fly   392 MQC----------LECKKI-VTPNTIKSLRAHK--FSHLSQPEWLR---CKLC--------YKGY 432

  Fly   254 TNNEKIKLDFSKKNKLTT----DLIEMYANFPQLYDSNHKEFSNMSSRKQAYESMAAEISVPNVD 314
            |::::|.....:::.:.|    |..|...:.|...:.   |....:...:...:...|.|....|
  Fly   433 TDHQEIIRHLLQQHHMDTLMSEDAEEEDGDAPSAIED---ECDGDNGNGEGNGAPLDEDSPYFED 494

  Fly   315 -------INSDDIF------------RAIQNLRQWYYKNTKHAIYAGSTAE--KFYLEVCRFMPA 358
                   |:|||||            :.....:.|    ..|.:.|.|..:  |...|:      
  Fly   495 APRRGGRISSDDIFEPHIDYLCPQCGKEFIEKKHW----RTHVVMAHSMNDLSKLNFEM------ 549

  Fly   359 KMYKQRLVCEFCHQITSSDHVLQSHIFKAHNIGELPFK----CTLCDRSFVGRCELANHIQRVH- 418
             :.:::|.|..|.:|.::.:.:|:  .:.|.|..||||    |..|.:|:..|..|..|:...| 
  Fly   550 -INERQLKCTECDKIITNAYGIQN--AQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHLATHHR 611

  Fly   419 IG--------------------------------------------------------------- 420
            :|                                                               
  Fly   612 VGWPRKLSGGCPAPILTPAKQPRKQIVTVANETYEIIYLDDVDQGGMEEDNDFGEQMQAEEDEYP 676

  Fly   421 --------------------KTHKCTHCERSFAVMSDLQLHIRTHTGHKP--------------- 450
                                :.:||.||...||..:.:::||......|.               
  Fly   677 IAPPPPSPPPPPQPTTQGNHQRYKCVHCGTLFATQAAVRVHISEKRCRKTVVRRRRQPVMSSADP 741

  Fly   451 ----------YVCEHCGKAFRLRSQMTLHVTAIHT-------------KIRAFKCTMCPKDFV-- 490
                      ::|..||..::.:.:...|:..:|.             |.| ::||.| ||.|  
  Fly   742 SVPTVEQNYIFLCPSCGFEYKTQFEWRRHINEVHNFDKRQYLNMRQLDKYR-YQCTQC-KDIVCN 804

  Fly   491 -KKVDLSDHIKGHLNIRDKI-CSVCG-----KGFTSCHALIRHRQIHSEVKKFVCK 539
             |...|.||...||..|..: |.:||     |...:.|...||.....|....:.|
  Fly   805 SKLKGLQDHHFRHLPYRLYLKCLICGTCYNHKPNIAAHLRARHSIFDRETPTMITK 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 20/102 (20%)
MADF_DNA_bdg 273..356 CDD:287510 18/103 (17%)
C2H2 Zn finger 367..388 CDD:275368 4/20 (20%)
C2H2 Zn finger 397..418 CDD:275368 6/20 (30%)
COG5048 <423..554 CDD:227381 38/164 (23%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
zf-H2C2_2 437..460 CDD:290200 6/47 (13%)
C2H2 Zn finger 453..470 CDD:275368 3/16 (19%)
C2H2 Zn finger 482..502 CDD:275368 10/22 (45%)
C2H2 Zn finger 510..530 CDD:275368 7/24 (29%)
C2H2 Zn finger 538..559 CDD:275368 1/2 (50%)
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368 4/20 (20%)
C2H2 Zn finger 516..532 CDD:275368 1/19 (5%)
C2H2 Zn finger 557..580 CDD:275368 6/24 (25%)
C2H2 Zn finger 589..609 CDD:275368 6/19 (32%)
COG5236 <939..>1096 CDD:227561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.