DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and hb

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster


Alignment Length:187 Identity:41/187 - (21%)
Similarity:68/187 - (36%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 PAKMYKQRLVCEFCH-QITSS-------------DHVLQSHIFKAHNIGELP-FKCTLCDRSFVG 406
            |||..:..:..|..| |:::|             |..::..|:.:|  |::. :||..|....:.
  Fly   189 PAKSSQSNIEPEKEHDQMSNSSEDMKYMAESEDDDTNIRMPIYNSH--GKMKNYKCKTCGVVAIT 251

  Fly   407 RCELANHIQRVHI--GKTHKCTHCERSFAVMSDLQLHIRTHTGHKPYVCEHCGKAFRLRSQMTLH 469
            :.:...| .|.|:  .|..:|..|.........|:.|||.|...||:.|:.|             
  Fly   252 KVDFWAH-TRTHMKPDKILQCPKCPFVTEFKHHLEYHIRKHKNQKPFQCDKC------------- 302

  Fly   470 VTAIHTKIRAFKCTMCPKDFVKKVDLSDHIKGHLNIRDKICSVCGKGFTSCHALIRH 526
                     ::.|       |.|..|:.|.|.|.::....|:.|......||:...|
  Fly   303 ---------SYTC-------VNKSMLNSHRKSHSSVYQYRCADCDYATKYCHSFKLH 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916
MADF_DNA_bdg 273..356 CDD:287510
C2H2 Zn finger 367..388 CDD:275368 6/34 (18%)
C2H2 Zn finger 397..418 CDD:275368 4/20 (20%)
COG5048 <423..554 CDD:227381 23/104 (22%)
C2H2 Zn finger 425..445 CDD:275368 6/19 (32%)
zf-H2C2_2 437..460 CDD:290200 9/22 (41%)
C2H2 Zn finger 453..470 CDD:275368 2/16 (13%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 5/17 (29%)
C2H2 Zn finger 538..559 CDD:275368
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368 4/20 (20%)
C2H2 Zn finger 271..291 CDD:275368 6/19 (32%)
zf-H2C2_2 283..308 CDD:290200 10/53 (19%)
C2H2 Zn finger 299..319 CDD:275368 8/48 (17%)
C2H2 Zn finger 327..345 CDD:275368 5/17 (29%)
C2H2 Zn finger 707..727 CDD:275371
C2H2 Zn finger 735..757 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.