DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and CG2199

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster


Alignment Length:815 Identity:121/815 - (14%)
Similarity:225/815 - (27%) Gaps:376/815 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LICVSRDYEKFLMRCSYCPTDV---------------EVAQWQEFVLHIRNVHS----------- 44
            |:|.:....:..:||.:|.|..               ::....|.:.| |::.|           
  Fly     5 LLCENMTKVQKEVRCDHCGTSQGSKSVFSGQKVFLGRKITDVLETITH-RSIPSSLPIKICFVCT 68

  Fly    45 -----------KVRSMEDDFEPVGENSTESGHVDPPEEK---------PQAEESIFQQDES---- 85
                       |||...|..:......|:...::.|..:         |:...::.|:.:|    
  Fly    69 STFMSSAALIEKVRETVDRVQEQPAKKTKVAEIEEPSTQESDKKAVKVPKKNTTLRQRSKSIAAF 133

  Fly    86 ----ADGACVQLHIDAVRSSTNETEE--------------------------------------- 107
                .:||.....|:.:.:|..:.::                                       
  Fly   134 PPSFVNGANTNTEIEIISASPKKLDKTPKKQISRLFEDNLNDSVKLTPAKEVSSTKKAFLNLFGN 198

  Fly   108 --SDVSLVTDEEESVQDEDPSEPALDDANLKTTPTYKFHPSFFRRDHRTIKFIEIYKEH------ 164
              :|...|..|.|..:|.|.....::..|.: .|..:||          .||.:.||||      
  Fly   199 GGNDAIEVLTESEEEEDSDKGPITINTNNFQ-CPECEFH----------AKFPKPYKEHLQKEHG 252

  Fly   165 -------PC------------LWN---PAHS---DYKEPKKCKEALKRMA-------IDLEATVS 197
                   ||            |.|   ..||   :.:...|.||:.::.|       ||.:|.  
  Fly   253 LQRPRIYPCTLCIKTFGVLKTLKNHLRDTHSRTFESEAKTKAKESKEKEAKSGAKNKIDAKAK-- 315

  Fly   198 VFLNEMALKLAIKKVHMQFNTVHKRVVSGKQKPQSLAFSIYKLCCFLNASNDEEGATNNEKIKLD 262
                                  ....||.::||                   :|..:..:|.::.
  Fly   316 ----------------------ETNAVSQRKKP-------------------KEKKSKEKKTEIK 339

  Fly   263 FSKKNKLTTDLIEMYAN--FPQLYDSNHKEFSNMSSRKQAYESMAAEISVPNVDINSDDIFRAIQ 325
            .:.:.|:..::.:...|  .....|::..:.:.::|.|...||:..:..:.|| |:|:..| || 
  Fly   340 CNVETKVVDEIDDQVNNKKGTDSEDADQTQATKIASFKALNESLMKKRMLENV-IDSEYTF-AI- 401

  Fly   326 NLRQWYYKNTKHAIYAGSTAEKFYLEVCRFMPAKMYKQRLVCEFCHQITSSDHVLQSHIFKAHNI 390
                    |...|....:.:..|..|:|.               |..:|:..  :|.|:...|:|
  Fly   402 --------NGSSASTPRADSNNFQCEICD---------------CELMTAKQ--MQEHMKTVHSI 441

  Fly   391 GELP--FKCTLCDRS-------------------------------------FVGRCELANHIQR 416
             :.|  |||.:|::|                                     .:|..::.|..::
  Fly   442 -DKPKVFKCHVCEKSLATKQSLKTHMTLHADGAEAPNSSKRKILQDEDEDVDILGTTQIENTAEK 505

  Fly   417 VH--------------------------------------------------------------- 418
            |.                                                               
  Fly   506 VEGPKKSQQSPTKAAKFTNRKILQEEDEVVEIVDAFKTDNTAEDDEGPAEEKIIRSRNNIQHQVD 570

  Fly   419 ---------IGKTHKCTHCERSFA-----------------------------VMSDLQLHIRTH 445
                     ..||.|.:|.:.|.:                             ::.::..::|.|
  Fly   571 GGMIAPRSPAKKTKKTSHVDLSVSTTNGNSPAKSEKRKKQDKSEDTLPSSDVDIVEEINYNVRPH 635

  Fly   446 ------------TGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRAFKCTMCPKDFVKKVDLSDH 498
                        .......|:.|||..:.|.::..|:...|.  ...:||:|.:.:..::|...|
  Fly   636 KKARLESIGDSTADESTLSCDRCGKFVKSRQRLDSHMEKKHA--AKLQCTLCKEVYQNQMDYVAH 698

  Fly   499 IKGHLNIRDKICSV--CGKGFTSCHALIRH-RQIH 530
            .....:.....|.|  |.|.||..:.|..| |:.|
  Fly   699 FSNCGSEGGLPCGVANCKKVFTEANFLSSHLRKRH 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 22/124 (18%)
MADF_DNA_bdg 273..356 CDD:287510 18/84 (21%)
C2H2 Zn finger 367..388 CDD:275368 4/20 (20%)
C2H2 Zn finger 397..418 CDD:275368 5/57 (9%)
COG5048 <423..554 CDD:227381 27/152 (18%)
C2H2 Zn finger 425..445 CDD:275368 3/48 (6%)
zf-H2C2_2 437..460 CDD:290200 6/34 (18%)
C2H2 Zn finger 453..470 CDD:275368 5/16 (31%)
C2H2 Zn finger 482..502 CDD:275368 5/19 (26%)
C2H2 Zn finger 510..530 CDD:275368 9/22 (41%)
C2H2 Zn finger 538..559 CDD:275368
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 6/37 (16%)
C2H2 Zn finger 449..469 CDD:275370 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.