DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and MESR4

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster


Alignment Length:830 Identity:145/830 - (17%)
Similarity:231/830 - (27%) Gaps:379/830 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VSRDYEKFLMRCSYCPTDVEVAQWQEFVLHIRNVHSKV--------------------------- 46
            :|:..|:| .|||.|   ..|.|...|.||:|.||.:.                           
  Fly   587 LSQKQERF-FRCSQC---CSVHQCWHFFLHMREVHRRYICLYCNHVYPSVEKLSLHLENKHDIDQ 647

  Fly    47 -----------RSMED------------------DFE---------PVGENSTESGHV------- 66
                       :|.||                  :||         |....:.:.||:       
  Fly   648 SHFAKDAWDQQQSKEDRARHLVCCTCQATFVQGSEFEDHDCSQLMQPCALCNQKGGHIIGCKNNK 712

  Fly    67 -----------DPPE----------EKPQAEESIFQQDESADGACVQLH---------------- 94
                       .|||          |:|...|:|.:|...      |||                
  Fly   713 RKPTKRRRKVRRPPEPPLPVSQEAVEQPVPVEAIPEQLPQ------QLHLQSDIQNPFPAENIPA 771

  Fly    95 -------------------------------IDAVRSSTNETEESDVSLVTDEEESVQDEDPSEP 128
                                           :||..||| :||:.::......||:|  ..|.|.
  Fly   772 PEPVEDPPAPPIPKLVVPKIMLRVPKEFQKSVDAALSST-DTEDEELETAQPVEEAV--SAPPED 833

  Fly   129 ALDDANLKTTPTYKFHPSFFRRDHRTIKFIEIYKEHPCLWNPAHSDYKEPKKCKEALKRMAIDLE 193
            ...||.....|...:..|...:.:|.:                           ..|:|..:|:|
  Fly   834 LPFDAPPPPPPALSYDDSTSSKLNRVL---------------------------AELERTKLDIE 871

  Fly   194 ATVSVFLNEMALKLAIKKVHMQFNTVHKRVVSGKQKPQSLAFSIYKLCCFLNASNDEE------- 251
            .|.:..:.:...|:.:...|:: |.|.:.|    ..||           .|....:|:       
  Fly   872 RTKADIITKKQSKIIMANAHLE-NVVPQVV----DPPQ-----------HLQPQQEEQRRWSLTP 920

  Fly   252 -GATNNEKIKL---------------DFSKKNKLTTDLIEM--YANFPQLYDSNHKEFSNMSSRK 298
             .:.:|..:.|               |..::|.|.:|.::|  ..|.|::..|  ::|:  .::|
  Fly   921 PASPHNNHVNLPEPPPALITEFQGQPDAVRRNSLGSDCMDMDDSLNAPEMEGS--RDFT--EAQK 981

  Fly   299 QAYES-------------------------MAAEISVPNVDINSD---DIFRAIQNLR------- 328
            :..|.                         |.|......||:..|   |.|..:..:|       
  Fly   982 ETLEPAPPSQDTQTADEPLAIQPLPPADGIMVAGPDTHTVDLQLDRPLDRFSMVDFVRLCLKSVY 1046

  Fly   329 -------------------------QWYYKNTKHAIYAGSTAEKFYLEVC-----RFMP------ 357
                                     |..:..|..:|    |||:.|.|..     .|:|      
  Fly  1047 SLCLYCNHARRIAVNVKQLVIHLIGQHRFTATVDSI----TAEELYAETIVAKLKSFLPNLENEY 1107

  Fly   358 --------------AKMYKQRLV-CEFCHQITSSDHVLQSHIFKAH---NIGELPFKCTLCDRSF 404
                          .:.:.:|:. |..|..:||:...|.:|..:.|   ||     .|.:|..:|
  Fly  1108 MNAASCCSLENGKYVEPFNERIYECFTCRFVTSTHKELYTHNRRLHIKSNI-----TCVMCQTNF 1167

  Fly   405 VGRCELANHI-----------------------------QRVHIGKTHK-CTHCERSFAVMSDLQ 439
            ....|:..||                             ..||:.|.|: |..|.......|.|.
  Fly  1168 YSYSEILCHICPGEVAGSVYDLQFRCCLCDMAPLPSAFRLMVHLRKQHQACDICLEDCQSQSKLS 1232

  Fly   440 LHIRTHTGHKPYVCEHCGKAFRLRSQMTLHVTAIHTKIRA----------------------FKC 482
            .|:..|  ...::|..||.|:|.:..::.|:...|....|                      |.|
  Fly  1233 SHVWKH--KLLHLCYRCGIAYRNKQDISKHLFWKHGTESAGCKQCLQKRWRHVYHFCVPPAEFPC 1295

  Fly   483 TMCPKDFVKKVDLSDHIKGHLNIRDKICSV--CGKGFTSCHALIRHRQIH 530
            ..|...|.|.:.|..|.:.|.......|:.  |.:.|.|...|::|...|
  Fly  1296 EQCGFVFSKAIYLEVHQRMHTGDFRYACTEEGCEEKFVSRKLLLKHASSH 1345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 12/86 (14%)
MADF_DNA_bdg 273..356 CDD:287510 23/149 (15%)
C2H2 Zn finger 367..388 CDD:275368 6/20 (30%)
C2H2 Zn finger 397..418 CDD:275368 6/49 (12%)
COG5048 <423..554 CDD:227381 30/133 (23%)
C2H2 Zn finger 425..445 CDD:275368 5/19 (26%)
zf-H2C2_2 437..460 CDD:290200 6/22 (27%)
C2H2 Zn finger 453..470 CDD:275368 5/16 (31%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 6/21 (29%)
C2H2 Zn finger 538..559 CDD:275368
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368 0/15 (0%)
C2H2 Zn finger 1295..1315 CDD:275370 6/19 (32%)
C2H2 Zn finger 1323..1341 CDD:275370 5/17 (29%)
PHD_ING 2110..2156 CDD:276980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.