DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1602 and CG12942

DIOPT Version :9

Sequence 1:NP_610291.2 Gene:CG1602 / 35684 FlyBaseID:FBgn0033186 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_610628.2 Gene:CG12942 / 36158 FlyBaseID:FBgn0033569 Length:686 Species:Drosophila melanogaster


Alignment Length:586 Identity:117/586 - (19%)
Similarity:190/586 - (32%) Gaps:185/586 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ESDVSLVTDEEESVQDEDPSEPALDDANLKTTPTYKFHPSFFRRDHRTIKFIEIYKEHPCLWNPA 171
            ||::.|.. |.:||:...|:......|:.:|.|..:|...|       .:|:|.| |.|...|..
  Fly    94 ESNLKLQA-EAKSVKLPSPTGELKRKASNETIPWNQFSQEF-------EQFVEGY-EGPIEENVL 149

  Fly   172 H-SDYKEPKKCKEALKRMAIDLEATVSVFLNEMALK---LAIKKVHMQFNTVHKRVVSGKQKPQS 232
            : ...|.|:          :|::|:.|   :|.|.|   :.:..|....|.:.:           
  Fly   150 YMRGTKVPR----------LDVDASSS---SETAPKEDEVILFDVKYDTNDLEE----------- 190

  Fly   233 LAFSIYKLCCFLNASNDEEGATNNEKI-------------------------KLDFSKKNKLTTD 272
                        ...||...|.|||..                         ..:|:.||...||
  Fly   191 ------------EDENDGSDAKNNETFFENSITPGESVMVVSVAEKAVENNNNYNFNNKNGDVTD 243

  Fly   273 --------LIEMYANFPQLYDSNHKEFSNMSSRKQAYESMAAEISVP------------------ 311
                    .:||..|......|...|.||.:..|    |...|:|.|                  
  Fly   244 EECDLIQRALEMTLNDDGCSQSPKNEASNETQLK----SNGIEVSSPLFIKLATTSSTTGNIPIL 304

  Fly   312 -----------------------NVDINSDDIFRAIQN-------LRQWYYKN----TKHAIYAG 342
                                   .:.:..|||....:|       ...:..|:    .||.|...
  Fly   305 KCNICQYTHTDAEQLKIHYKSIHKISMMEDDIIGLNKNQNFKCRPCNSYETKDRSEMQKHLIDHH 369

  Fly   343 STAEKFYLEVCRFMPAKMYKQRLVCEFCHQITSSDHVLQSHIFKAH---NIGELP---FKCTLCD 401
            .....|  |:..:|.|.       |..|.:|.......:.|..:.|   .|...|   :.||.||
  Fly   370 KIDGDF--EMYCYMQAN-------CPACDRIFKDQRSARKHYTRVHTPVQIAVSPTESYACTACD 425

  Fly   402 RSFVGRCELANHIQRVHIGKTHKCTHCERSFAVMSDLQLHI-RTHTGHKPYVCEHCGKAFRLRSQ 465
            :.|..:..|.:|.:...:.....|:.|::.|..|...:||: :.|.....:.||.|.::|:....
  Fly   426 KVFNQKASLHSHQRFCQVKDVVHCSFCDQQFNSMRKYELHLQQLHAVETVHECEICRRSFKSAET 490

  Fly   466 MTLHVTAIHTKIRAFKCTMCPKDFVKKVDLSDHI-KGHLNIRDKICSVCGKGFTSCHALIRHRQ- 528
            :|:| ...|:: |.::|..|..::|...:|..|. :.|:|.....|..||..|.:...|..|.| 
  Fly   491 LTMH-RKRHSE-RHYQCGKCSLNYVNSAELRVHYERAHVNEEPVSCLTCGNQFQNMTLLREHEQR 553

  Fly   529 IHSEVKKFVCKLCD---------------------------SRFSQFVGLNTHMKRTHNILRNNS 566
            .|.:.|.:.|::|:                           |.|:.......|.|:.|.|..::.
  Fly   554 SHQKSKVWRCEVCNFETKTRWRRRQHQYEHMDYPYKCQKCTSEFADRSKFRQHSKKVHGIELSDE 618

  Fly   567 Q 567
            |
  Fly   619 Q 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1602NP_610291.2 GT1 157..244 CDD:304916 16/90 (18%)
MADF_DNA_bdg 273..356 CDD:287510 22/134 (16%)
C2H2 Zn finger 367..388 CDD:275368 4/20 (20%)
C2H2 Zn finger 397..418 CDD:275368 7/20 (35%)
COG5048 <423..554 CDD:227381 35/160 (22%)
C2H2 Zn finger 425..445 CDD:275368 6/20 (30%)
zf-H2C2_2 437..460 CDD:290200 6/23 (26%)
C2H2 Zn finger 453..470 CDD:275368 5/16 (31%)
C2H2 Zn finger 482..502 CDD:275368 5/20 (25%)
C2H2 Zn finger 510..530 CDD:275368 7/20 (35%)
C2H2 Zn finger 538..559 CDD:275368 6/47 (13%)
CG12942NP_610628.2 zf-AD 22..101 CDD:285071 3/6 (50%)
C2H2 Zn finger 385..406 CDD:275368 4/20 (20%)
C2H2 Zn finger 421..470 CDD:275368 13/48 (27%)
C2H2 Zn finger 449..466 CDD:275371 5/16 (31%)
C2H2 Zn finger 478..498 CDD:275368 6/20 (30%)
C2H2 Zn finger 505..526 CDD:275368 5/20 (25%)
C2H2 Zn finger 534..555 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.